Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|410200
Gene name
Locationscaffold_07:1989800..1992123
Strand+
Gene length (bp)2323
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 6.0E-76 29 460
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 1.5E-07 468 553

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 1 561 8.0E-58
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 2 561 2.0E-57
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 35 559 3.0E-57
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 4 567 1.0E-56
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 2 561 2.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 1 561 8.0E-58
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 2 561 2.0E-57
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 35 559 3.0E-57
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 4 567 1.0E-56
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 2 561 2.0E-55
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 35 559 1.0E-54
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 36 561 2.0E-53
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 36 560 5.0E-53
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 36 559 8.0E-53
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 35 567 1.0E-52
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 36 564 2.0E-51
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 36 561 2.0E-51
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 144 571 2.0E-51
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 35 559 4.0E-51
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 36 562 2.0E-50
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 32 561 1.0E-48
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 36 559 2.0E-48
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 143 573 2.0E-48
sp|Q9LQ12|4CLL1_ARATH 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 3 562 3.0E-48
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 185 562 4.0E-48
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 4 566 6.0E-48
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 142 560 9.0E-48
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 1 571 1.0E-47
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 3 568 6.0E-47
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 4 567 7.0E-47
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 1 570 4.0E-46
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 144 571 8.0E-46
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 144 571 1.0E-45
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 189 564 1.0E-45
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 144 560 5.0E-45
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 34 559 1.0E-44
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 3 560 2.0E-44
sp|Q7F1X5|4CLL5_ORYSJ 4-coumarate--CoA ligase-like 5 OS=Oryza sativa subsp. japonica GN=4CLL5 PE=2 SV=1 9 562 6.0E-44
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 162 560 7.0E-44
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 3 560 3.0E-43
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 7 562 4.0E-43
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 174 564 6.0E-43
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 33 560 9.0E-42
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 197 564 2.0E-41
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 33 560 3.0E-41
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 189 560 3.0E-40
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 7 567 4.0E-40
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 7 567 4.0E-40
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 7 567 4.0E-40
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 169 564 6.0E-40
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 175 557 2.0E-39
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 188 562 5.0E-39
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 184 561 5.0E-38
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 157 562 8.0E-38
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 188 505 2.0E-37
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 53 567 1.0E-36
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 53 567 1.0E-36
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 36 562 6.0E-36
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 77 562 3.0E-35
sp|P31686|4CL1_SOYBN 4-coumarate--CoA ligase 1 (Fragment) OS=Glycine max PE=2 SV=1 271 560 4.0E-35
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 187 478 2.0E-34
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 187 567 3.0E-33
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 192 567 7.0E-31
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 48 560 1.0E-30
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 24 559 2.0E-30
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 78 564 2.0E-30
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 71 560 3.0E-30
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 81 570 7.0E-30
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 78 559 8.0E-30
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 31 560 1.0E-29
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 71 560 1.0E-29
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 71 560 2.0E-29
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 71 560 2.0E-29
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 71 560 3.0E-29
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 71 560 3.0E-29
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 30 562 3.0E-29
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 186 573 3.0E-29
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 78 564 3.0E-29
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 78 564 4.0E-29
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 71 560 4.0E-29
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 78 564 6.0E-29
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 78 564 7.0E-29
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 71 560 9.0E-29
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 71 560 1.0E-28
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 78 564 1.0E-28
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 78 564 1.0E-28
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 78 564 1.0E-28
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 78 564 2.0E-28
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 71 560 2.0E-28
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 78 564 2.0E-28
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 35 560 3.0E-28
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 71 560 5.0E-28
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 71 560 5.0E-28
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 78 564 5.0E-28
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 194 556 5.0E-27
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 35 560 6.0E-27
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 35 560 6.0E-27
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 81 564 7.0E-27
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 66 553 1.0E-26
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 32 563 1.0E-26
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 32 563 1.0E-26
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 196 567 2.0E-26
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 77 560 3.0E-26
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 35 560 3.0E-26
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 35 560 4.0E-26
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 35 560 4.0E-26
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 35 560 4.0E-26
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 35 560 4.0E-26
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 196 567 8.0E-26
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 35 560 8.0E-26
sp|Q8GVF9|4CLL8_ORYSJ Putative 4-coumarate--CoA ligase-like 8 OS=Oryza sativa subsp. japonica GN=4CLL8 PE=3 SV=1 188 567 8.0E-26
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 196 568 1.0E-25
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 196 567 1.0E-25
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 71 560 2.0E-25
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 35 560 2.0E-25
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 77 560 2.0E-25
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 35 560 4.0E-25
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 66 566 4.0E-25
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 35 560 4.0E-25
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 35 560 4.0E-25
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 194 571 5.0E-25
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 35 560 5.0E-25
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 71 560 5.0E-25
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 35 560 5.0E-25
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 35 560 5.0E-25
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 35 560 6.0E-25
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 35 560 8.0E-25
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 35 560 1.0E-24
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 48 566 1.0E-24
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 35 560 2.0E-24
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 35 560 2.0E-24
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 35 560 2.0E-24
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 165 563 2.0E-24
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 196 568 9.0E-24
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 48 562 1.0E-23
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 68 566 1.0E-23
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 72 566 2.0E-23
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 35 560 2.0E-23
sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 185 562 4.0E-23
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 97 562 6.0E-23
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 113 566 6.0E-23
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 97 562 8.0E-23
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 188 572 1.0E-22
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 97 560 1.0E-22
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 44 564 2.0E-22
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 121 560 2.0E-22
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 114 566 4.0E-22
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 97 562 5.0E-22
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 148 572 5.0E-22
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 194 553 6.0E-22
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 71 560 7.0E-22
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 32 471 1.0E-21
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 192 563 1.0E-21
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 116 559 2.0E-21
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 114 564 3.0E-21
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 42 567 3.0E-21
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 192 563 4.0E-21
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 196 567 5.0E-21
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 31 562 5.0E-21
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 44 564 6.0E-21
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 113 566 6.0E-21
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 116 562 8.0E-21
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 192 562 9.0E-21
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 192 563 1.0E-20
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 189 571 2.0E-20
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 184 567 2.0E-20
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 188 564 3.0E-20
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 2 560 5.0E-20
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 73 559 5.0E-20
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 73 559 5.0E-20
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 73 559 5.0E-20
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 73 559 5.0E-20
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 73 559 5.0E-20
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 73 559 6.0E-20
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 2 560 7.0E-20
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 73 559 7.0E-20
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 73 559 1.0E-19
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 73 559 1.0E-19
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 35 523 1.0E-19
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 114 562 2.0E-19
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 166 562 3.0E-19
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 166 562 3.0E-19
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 166 562 3.0E-19
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 196 567 3.0E-19
sp|Q9XIA9|LACS2_ARATH Long chain acyl-CoA synthetase 2 OS=Arabidopsis thaliana GN=LACS2 PE=2 SV=1 53 559 3.0E-19
sp|P19409|BAIB_CLOSV Bile acid-coenzyme A ligase OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiB PE=1 SV=1 246 561 4.0E-19
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 129 567 5.0E-19
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 113 566 7.0E-19
sp|Q5HRH4|VRAA_STAEQ Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=vraA PE=3 SV=1 171 474 9.0E-19
sp|Q8CQ67|VRAA_STAES Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=vraA PE=3 SV=1 171 474 1.0E-18
sp|Q8CS21|MENE_STAES 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menE PE=3 SV=1 81 566 1.0E-18
sp|Q53634|MENE_STAAU 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus GN=menE PE=3 SV=1 73 559 1.0E-18
sp|A8Z4L9|MENE_STAAT 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menE PE=3 SV=1 73 559 1.0E-18
sp|A6QHX6|MENE_STAAE 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Newman) GN=menE PE=3 SV=1 73 559 1.0E-18
sp|Q5HEY2|MENE_STAAC 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain COL) GN=menE PE=3 SV=1 73 559 1.0E-18
sp|Q2G2V3|MENE_STAA8 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=menE PE=3 SV=1 73 559 1.0E-18
sp|Q2FFU9|MENE_STAA3 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300) GN=menE PE=3 SV=1 73 559 1.0E-18
sp|B2HGV4|FAC15_MYCMM Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD15 PE=3 SV=1 70 569 4.0E-18
sp|Q9SFW5|AEE21_ARATH Probable acyl-activating enzyme 21 OS=Arabidopsis thaliana GN=AEE21 PE=3 SV=1 106 569 4.0E-18
sp|Q7TYX8|FAC15_MYCBO Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD15 PE=3 SV=2 71 569 4.0E-18
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 194 565 6.0E-18
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 69 570 7.0E-18
sp|Q91VE0|S27A4_MOUSE Long-chain fatty acid transport protein 4 OS=Mus musculus GN=Slc27a4 PE=1 SV=1 32 522 9.0E-18
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 66 570 1.0E-17
sp|Q5HNB2|MENE_STAEQ 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 81 566 2.0E-17
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 185 473 2.0E-17
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 193 564 3.0E-17
sp|O60135|LCF1_SCHPO Long-chain-fatty-acid--CoA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf1 PE=3 SV=1 71 458 4.0E-17
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 171 566 4.0E-17
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 171 566 4.0E-17
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 171 566 4.0E-17
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 194 561 4.0E-17
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 152 477 5.0E-17
sp|P9WQ51|FAC19_MYCTU Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD19 PE=1 SV=1 193 566 5.0E-17
sp|P9WQ50|FAC19_MYCTO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD19 PE=3 SV=1 193 566 5.0E-17
sp|Q7TWB7|FAC19_MYCBO Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD19 PE=3 SV=1 193 566 5.0E-17
sp|Q00594|ALKK_PSEOL Medium-chain-fatty-acid--CoA ligase OS=Pseudomonas oleovorans GN=alkK PE=3 SV=1 138 563 5.0E-17
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 43 560 6.0E-17
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 187 567 7.0E-17
sp|B2HIL6|FAA22_MYCMM p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD22 PE=1 SV=1 189 562 7.0E-17
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 180 560 1.0E-16
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 48 559 1.0E-16
sp|Q9ES38|S27A5_RAT Bile acyl-CoA synthetase OS=Rattus norvegicus GN=Slc27a5 PE=1 SV=1 101 525 2.0E-16
sp|O53521|FAC15_MYCTU Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD15 PE=1 SV=3 71 569 2.0E-16
sp|Q9SS01|AAE20_ARATH Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 194 565 2.0E-16
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 190 502 4.0E-16
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 41 560 4.0E-16
sp|Q554Z5|ACSB_DICDI Acyl-CoA synthetase short-chain family member B, mitochondrial OS=Dictyostelium discoideum GN=aslB PE=3 SV=1 193 563 4.0E-16
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 32 561 4.0E-16
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 32 561 4.0E-16
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 192 560 6.0E-16
sp|Q1H0J2|ACSA_METFK Acetyl-coenzyme A synthetase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=acsA PE=3 SV=1 193 565 7.0E-16
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 190 473 7.0E-16
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 43 562 8.0E-16
sp|A4G3L8|ACSA_HERAR Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 4 560 8.0E-16
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 33 477 1.0E-15
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 80 559 1.0E-15
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 48 560 1.0E-15
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 157 561 1.0E-15
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 187 565 1.0E-15
sp|A5JTM6|CBACL_PSEUC 4-chlorobenzoate--CoA ligase OS=Pseudomonas sp. (strain CBS-3) PE=1 SV=1 185 571 2.0E-15
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 188 559 2.0E-15
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 185 473 2.0E-15
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 185 473 2.0E-15
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 185 473 2.0E-15
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 133 559 3.0E-15
sp|Q4R3Y4|S27A4_MACFA Long-chain fatty acid transport protein 4 OS=Macaca fascicularis GN=SLC27A4 PE=2 SV=2 32 489 3.0E-15
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 66 566 3.0E-15
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 189 561 3.0E-15
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 192 560 3.0E-15
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 17 560 3.0E-15
sp|B3R1X2|ACSA_CUPTR Acetyl-coenzyme A synthetase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=acsA PE=3 SV=1 4 565 5.0E-15
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 191 491 5.0E-15
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 48 566 6.0E-15
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 149 474 8.0E-15
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 180 561 8.0E-15
sp|Q9JID6|ACSL1_CAVPO Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1 53 472 9.0E-15
sp|Q6P1M0|S27A4_HUMAN Long-chain fatty acid transport protein 4 OS=Homo sapiens GN=SLC27A4 PE=1 SV=1 32 522 1.0E-14
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 186 559 2.0E-14
sp|P9WQ49|FAD21_MYCTU Putative fatty-acid--CoA ligase FadD21 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD21 PE=1 SV=1 190 573 2.0E-14
sp|P9WQ48|FAD21_MYCTO Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD21 PE=3 SV=1 190 573 2.0E-14
sp|P63524|FAD21_MYCBO Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD21 PE=3 SV=1 190 573 2.0E-14
sp|Q9SEY5|AAE2_ARATH Probable acyl-activating enzyme 2 OS=Arabidopsis thaliana GN=AAE2 PE=2 SV=1 197 487 2.0E-14
sp|Q5RDY4|S27A4_PONAB Long-chain fatty acid transport protein 4 OS=Pongo abelii GN=SLC27A4 PE=2 SV=1 32 522 2.0E-14
sp|Q9T009|LACS5_ARATH Long chain acyl-CoA synthetase 5 OS=Arabidopsis thaliana GN=LACS5 PE=2 SV=1 53 490 2.0E-14
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 313 560 3.0E-14
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 194 556 3.0E-14
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 194 556 3.0E-14
sp|Q46Z41|ACSA_CUPPJ Acetyl-coenzyme A synthetase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=acsA PE=3 SV=1 193 565 3.0E-14
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 168 566 3.0E-14
sp|Q9C9G2|AEE22_ARATH Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 404 556 3.0E-14
sp|Q9CHK3|MENE_LACLA 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 81 560 4.0E-14
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 191 496 5.0E-14
sp|O53551|FAC17_MYCTU Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD17 PE=1 SV=1 168 562 5.0E-14
sp|Q7TWC5|FAC17_MYCBO Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD17 PE=3 SV=1 168 562 5.0E-14
sp|P54200|FAD21_MYCLE Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium leprae (strain TN) GN=fadD21 PE=3 SV=2 190 564 6.0E-14
sp|Q0AFF1|ACSA_NITEC Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 285 565 6.0E-14
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 182 473 6.0E-14
sp|B2HI05|FAC19_MYCMM Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 76 566 1.0E-13
sp|Q8XY11|ACSA_RALSO Acetyl-coenzyme A synthetase OS=Ralstonia solanacearum (strain GMI1000) GN=acsA PE=3 SV=1 183 565 2.0E-13
sp|Q4L3Q0|VRAA_STAHJ Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=vraA PE=3 SV=1 187 569 2.0E-13
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 101 564 2.0E-13
sp|B2HIM0|FAA28_MYCMM Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 192 563 3.0E-13
sp|Q4LDG0|S27A5_MOUSE Bile acyl-CoA synthetase OS=Mus musculus GN=Slc27a5 PE=1 SV=2 101 525 3.0E-13
sp|B2U6V1|ACSA_RALPJ Acetyl-coenzyme A synthetase OS=Ralstonia pickettii (strain 12J) GN=acsA PE=3 SV=1 183 565 3.0E-13
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 179 473 3.0E-13
sp|P31638|ACSA_CUPNH Acetyl-coenzyme A synthetase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acsA PE=3 SV=1 183 565 3.0E-13
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 193 565 3.0E-13
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 145 559 4.0E-13
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 192 476 4.0E-13
sp|O88561|S27A3_MOUSE Long-chain fatty acid transport protein 3 OS=Mus musculus GN=Slc27a3 PE=1 SV=2 117 490 5.0E-13
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 173 561 5.0E-13
sp|Q1ZXQ4|FCSB_DICDI Fatty acyl-CoA synthetase B OS=Dictyostelium discoideum GN=fcsB PE=2 SV=1 48 474 6.0E-13
sp|P97524|S27A2_RAT Very long-chain acyl-CoA synthetase OS=Rattus norvegicus GN=Slc27a2 PE=1 SV=1 48 473 8.0E-13
sp|O42633|FAT1_COCHE Fatty acid transporter protein OS=Cochliobolus heterostrophus GN=FAT1 PE=3 SV=1 78 489 1.0E-12
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 193 566 1.0E-12
sp|Q8KBY0|ACSA_CHLTE Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 193 561 1.0E-12
sp|Q82SI5|ACSA_NITEU Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 193 560 1.0E-12
sp|Q9Y2P5|S27A5_HUMAN Bile acyl-CoA synthetase OS=Homo sapiens GN=SLC27A5 PE=1 SV=1 58 525 1.0E-12
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 189 559 2.0E-12
sp|P33124|ACSL6_RAT Long-chain-fatty-acid--CoA ligase 6 OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 48 474 2.0E-12
sp|B2HHZ8|FAC17_MYCMM Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD17 PE=3 SV=1 167 559 2.0E-12
sp|Q9P7D7|LCF2_SCHPO Long-chain-fatty-acid--CoA ligase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf2 PE=3 SV=1 50 485 2.0E-12
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 140 477 3.0E-12
sp|O35488|S27A2_MOUSE Very long-chain acyl-CoA synthetase OS=Mus musculus GN=Slc27a2 PE=1 SV=2 48 473 3.0E-12
sp|E3UUE6|FAC19_RHORH 3-oxocholest-4-en-26-oate--CoA ligase OS=Rhodococcus rhodochrous GN=fadD19 PE=1 SV=1 40 562 3.0E-12
sp|P33121|ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens GN=ACSL1 PE=1 SV=1 53 474 3.0E-12
sp|B2HIL4|FAA29_MYCMM Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD29 PE=3 SV=1 181 502 3.0E-12
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 193 560 3.0E-12
sp|Q3SLF4|ACSA_THIDA Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 193 560 4.0E-12
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 193 560 4.0E-12
sp|Q9X928|ACSA_STRCO Acetyl-coenzyme A synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=acsA PE=3 SV=1 193 571 5.0E-12
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 191 478 5.0E-12
sp|Q1LL27|ACSA_CUPMC Acetyl-coenzyme A synthetase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=acsA PE=3 SV=1 193 565 6.0E-12
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 29 559 7.0E-12
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 191 559 9.0E-12
sp|Q5K4L6|S27A3_HUMAN Long-chain fatty acid transport protein 3 OS=Homo sapiens GN=SLC27A3 PE=2 SV=3 117 490 1.0E-11
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 187 560 1.0E-11
sp|Q2NR28|ACSA_SODGM Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 193 560 1.0E-11
sp|Q3ZKN0|S27A1_BOVIN Long-chain fatty acid transport protein 1 OS=Bos taurus GN=SLC27A1 PE=2 SV=1 193 490 1.0E-11
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 193 559 2.0E-11
sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 279 560 2.0E-11
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 131 477 2.0E-11
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 169 501 2.0E-11
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 170 472 3.0E-11
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 186 559 4.0E-11
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 147 559 4.0E-11
sp|Q6PCB7|S27A1_HUMAN Long-chain fatty acid transport protein 1 OS=Homo sapiens GN=SLC27A1 PE=2 SV=1 32 490 4.0E-11
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 170 472 4.0E-11
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 170 472 4.0E-11
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 149 559 5.0E-11
sp|Q48G09|ACSA_PSE14 Acetyl-coenzyme A synthetase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=acsA PE=3 SV=1 279 560 5.0E-11
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 192 473 5.0E-11
sp|P9WQ53|FAD11_MYCTU Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD11 PE=3 SV=1 312 475 5.0E-11
sp|P9WQ52|FAD11_MYCTO Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD11 PE=3 SV=1 312 475 5.0E-11
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 29 559 5.0E-11
sp|Q9SJD4|LACS8_ARATH Long chain acyl-CoA synthetase 8 OS=Arabidopsis thaliana GN=LACS8 PE=1 SV=1 37 259 6.0E-11
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 149 559 7.0E-11
sp|O14975|S27A2_HUMAN Very long-chain acyl-CoA synthetase OS=Homo sapiens GN=SLC27A2 PE=1 SV=2 48 473 7.0E-11
sp|Q9VP61|ACSA_DROME Acetyl-coenzyme A synthetase OS=Drosophila melanogaster GN=AcCoAS PE=2 SV=1 286 560 7.0E-11
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 193 560 7.0E-11
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 172 501 7.0E-11
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 172 501 7.0E-11
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 179 474 7.0E-11
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 180 560 8.0E-11
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 172 501 8.0E-11
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 149 474 8.0E-11
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 193 560 9.0E-11
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 191 559 1.0E-10
sp|O95573|ACSL3_HUMAN Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens GN=ACSL3 PE=1 SV=3 81 477 1.0E-10
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 192 560 1.0E-10
sp|Q9V3S9|BGM_DROME Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster GN=bgm PE=2 SV=1 289 473 1.0E-10
sp|O22898|LACS1_ARATH Long chain acyl-CoA synthetase 1 OS=Arabidopsis thaliana GN=LACS1 PE=2 SV=1 70 490 1.0E-10
sp|C1AA44|ACSA_GEMAT Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 172 566 1.0E-10
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 169 501 1.0E-10
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 32 559 2.0E-10
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 193 559 2.0E-10
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 178 501 2.0E-10
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 193 559 2.0E-10
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 193 559 2.0E-10
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 193 559 2.0E-10
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 193 559 2.0E-10
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 193 559 2.0E-10
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 172 501 2.0E-10
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 172 501 2.0E-10
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 172 501 2.0E-10
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 172 501 2.0E-10
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 172 501 2.0E-10
sp|Q885K7|ACSA_PSESM Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=acsA PE=3 SV=1 279 560 2.0E-10
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 172 501 2.0E-10
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 172 501 2.0E-10
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 172 501 2.0E-10
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 193 559 2.0E-10
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 193 559 2.0E-10
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 193 559 2.0E-10
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 186 473 3.0E-10
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 172 501 3.0E-10
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 172 501 3.0E-10
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 172 501 3.0E-10
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 193 560 3.0E-10
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 287 560 3.0E-10
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 172 501 3.0E-10
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 172 501 3.0E-10
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 193 560 3.0E-10
sp|Q5R668|ACSL3_PONAB Long-chain-fatty-acid--CoA ligase 3 OS=Pongo abelii GN=ACSL3 PE=2 SV=2 81 477 3.0E-10
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 184 472 3.0E-10
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 172 501 3.0E-10
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 172 501 3.0E-10
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 184 472 3.0E-10
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 184 472 3.0E-10
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 184 472 3.0E-10
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 184 472 3.0E-10
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 187 475 3.0E-10
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 187 559 4.0E-10
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 167 560 4.0E-10
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 172 501 4.0E-10
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 189 473 5.0E-10
sp|O05598|Y1013_MYCTU Putative ligase Rv1013 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks16 PE=1 SV=2 181 471 5.0E-10
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 285 566 5.0E-10
sp|P44446|LCFH_HAEIN Putative long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0002 PE=3 SV=1 324 569 5.0E-10
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 149 489 6.0E-10
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 172 480 6.0E-10
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 172 474 7.0E-10
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 172 474 7.0E-10
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 192 559 7.0E-10
sp|B2JD61|ACSA_BURP8 Acetyl-coenzyme A synthetase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=acsA PE=3 SV=1 193 565 7.0E-10
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 193 559 7.0E-10
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 193 559 7.0E-10
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 193 559 7.0E-10
sp|A4YGR1|HPCAS_METS5 3-hydroxypropionyl-coenzyme A synthetase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1456 PE=1 SV=1 183 560 8.0E-10
sp|A6WM52|ACSA_SHEB8 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 285 560 8.0E-10
sp|A3D3E8|ACSA_SHEB5 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 285 560 8.0E-10
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 193 559 8.0E-10
sp|Q3IFM6|ACSA_PSEHT Acetyl-coenzyme A synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=acsA PE=3 SV=1 193 560 8.0E-10
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 132 559 9.0E-10
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 193 559 9.0E-10
sp|A9KY56|ACSA_SHEB9 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS195) GN=acsA PE=3 SV=1 285 560 9.0E-10
sp|A0R3D6|Y5435_MYCS2 Putative ligase MSMEG_5435/MSMEI_5285 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_5435 PE=1 SV=1 188 557 9.0E-10
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 178 475 9.0E-10
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 178 475 9.0E-10
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 178 475 9.0E-10
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 178 475 9.0E-10
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 172 474 1.0E-09
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 172 474 1.0E-09
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 179 475 1.0E-09
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 179 475 1.0E-09
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 172 474 1.0E-09
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 190 477 1.0E-09
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 172 474 1.0E-09
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 172 474 1.0E-09
sp|Q2T3N9|ACSA_BURTA Acetyl-coenzyme A synthetase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=acsA PE=3 SV=1 286 565 1.0E-09
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 172 474 1.0E-09
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 172 474 1.0E-09
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 172 474 1.0E-09
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 172 474 1.0E-09
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 172 474 1.0E-09
sp|A0KY83|ACSA_SHESA Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain ANA-3) GN=acsA PE=3 SV=1 193 560 1.0E-09
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 172 474 1.0E-09
sp|P9WQ45|FAD25_MYCTU Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD25 PE=1 SV=1 193 473 1.0E-09
sp|P9WQ44|FAD25_MYCTO Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD25 PE=3 SV=1 193 473 1.0E-09
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 176 560 1.0E-09
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 75 501 1.0E-09
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 179 475 1.0E-09
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 179 475 1.0E-09
sp|Q60714|S27A1_MOUSE Long-chain fatty acid transport protein 1 OS=Mus musculus GN=Slc27a1 PE=1 SV=1 193 490 1.0E-09
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 184 559 2.0E-09
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 193 560 2.0E-09
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 176 560 2.0E-09
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 145 565 2.0E-09
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 172 501 2.0E-09
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 172 501 2.0E-09
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 172 501 2.0E-09
sp|Q8LKS5|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 3 472 2.0E-09
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 145 565 2.0E-09
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 184 472 2.0E-09
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 184 472 2.0E-09
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 172 501 2.0E-09
sp|O25686|ACSA_HELPY Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=acsA PE=3 SV=1 167 560 2.0E-09
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 180 553 2.0E-09
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 183 566 2.0E-09
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 177 472 2.0E-09
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 177 472 2.0E-09
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 149 559 3.0E-09
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 170 473 3.0E-09
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 177 472 3.0E-09
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 177 472 3.0E-09
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 177 472 3.0E-09
sp|A1SZA2|ACSA_PSYIN Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 193 560 3.0E-09
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 186 476 3.0E-09
sp|Q0HTY6|ACSA_SHESR Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 193 560 3.0E-09
sp|Q0HHN4|ACSA_SHESM Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 193 560 3.0E-09
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 177 472 3.0E-09
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 177 472 3.0E-09
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 177 472 3.0E-09
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 177 472 3.0E-09
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 186 476 3.0E-09
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 177 472 3.0E-09
sp|P9WQ47|FAC23_MYCTU Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD23 PE=1 SV=1 189 473 3.0E-09
sp|P9WQ46|FAC23_MYCTO Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD23 PE=3 SV=1 189 473 3.0E-09
sp|Q7TVK7|FAC23_MYCBO Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD23 PE=3 SV=1 189 473 3.0E-09
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 193 560 3.0E-09
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 179 553 4.0E-09
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 149 559 4.0E-09
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 193 559 4.0E-09
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 193 560 4.0E-09
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 184 560 4.0E-09
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 177 472 4.0E-09
sp|P97849|S27A1_RAT Long-chain fatty acid transport protein 1 OS=Rattus norvegicus GN=Slc27a1 PE=2 SV=1 193 490 4.0E-09
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 145 565 4.0E-09
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 145 565 4.0E-09
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 145 565 4.0E-09
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 145 565 4.0E-09
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 145 565 4.0E-09
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 145 565 4.0E-09
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 145 565 4.0E-09
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 193 571 5.0E-09
sp|Q6FXI2|ACS2_CANGA Acetyl-coenzyme A synthetase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS2 PE=3 SV=1 175 560 5.0E-09
sp|Q1CUA3|ACSA_HELPH Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain HPAG1) GN=acsA PE=3 SV=1 167 560 5.0E-09
sp|B5Z6E9|ACSA_HELPG Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain G27) GN=acsA PE=3 SV=1 167 560 5.0E-09
sp|B2HPY8|FAA30_MYCMM Long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD30 PE=3 SV=1 193 563 5.0E-09
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 32 572 6.0E-09
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 191 505 6.0E-09
sp|Q6MNF1|ACSA_BDEBA Acetyl-coenzyme A synthetase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=acsA PE=3 SV=1 184 560 6.0E-09
sp|Q17WR1|ACSA_HELAH Acetyl-coenzyme A synthetase OS=Helicobacter acinonychis (strain Sheeba) GN=acsA PE=3 SV=1 167 560 6.0E-09
sp|Q88EH6|ACSA1_PSEPK Acetyl-coenzyme A synthetase 1 OS=Pseudomonas putida (strain KT2440) GN=acsA1 PE=3 SV=1 279 569 6.0E-09
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 191 474 7.0E-09
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 192 492 7.0E-09
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 193 472 7.0E-09
sp|A1RIK1|ACSA_SHESW Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain W3-18-1) GN=acsA PE=3 SV=1 285 560 7.0E-09
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 193 472 7.0E-09
sp|A4Y7Y7|ACSA_SHEPC Acetyl-coenzyme A synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=acsA PE=3 SV=1 285 560 7.0E-09
sp|A1S7C8|ACSA_SHEAM Acetyl-coenzyme A synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=acsA PE=3 SV=1 285 560 7.0E-09
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 149 559 8.0E-09
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 191 559 8.0E-09
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 191 559 8.0E-09
sp|B6JKX8|ACSA_HELP2 Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain P12) GN=acsA PE=3 SV=1 167 560 8.0E-09
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 32 476 9.0E-09
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 149 477 9.0E-09
sp|Q2G512|ACSA_NOVAD Acetyl-coenzyme A synthetase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=acsA PE=3 SV=1 183 560 9.0E-09
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 189 559 1.0E-08
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 149 477 1.0E-08
sp|Q9A2I0|ACSA_CAUCR Acetyl-coenzyme A synthetase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=acsA PE=3 SV=1 184 567 1.0E-08
sp|A8H5P1|ACSA_SHEPA Acetyl-coenzyme A synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=acsA PE=3 SV=1 285 560 1.0E-08
sp|Q8EDK3|ACSA_SHEON Acetyl-coenzyme A synthetase OS=Shewanella oneidensis (strain MR-1) GN=acsA PE=3 SV=1 193 560 1.0E-08
sp|P95141|FAA29_MYCTU Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD29 PE=1 SV=1 187 500 1.0E-08
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 185 476 1.0E-08
sp|Q7TXK5|FAA29_MYCBO Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD29 PE=3 SV=1 187 500 1.0E-08
sp|O68040|ACSA_RHOCB Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 286 560 2.0E-08
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 192 473 2.0E-08
sp|Q750T7|ACS2_ASHGO Acetyl-coenzyme A synthetase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS2 PE=3 SV=1 193 560 2.0E-08
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 192 473 2.0E-08
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 155 562 2.0E-08
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 167 559 3.0E-08
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 32 559 3.0E-08
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 189 565 3.0E-08
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 188 559 4.0E-08
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 191 509 2.0E-07
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 81 559 2.0E-07
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 149 470 1.0E-06
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 191 474 1.0E-06
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 140 559 2.0E-06
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 191 478 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1240
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|017190
Agaricus bisporus var bisporus H39 AgabiH39|105440
Agaricus bisporus var bisporus H39 AgabiH39|410200 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|017190
Agaricus bisporus var bisporus H97 AgabiH97|105430
Agaricus bisporus var bisporus H97 AgabiH97|105440
Rhodonia placenta FPRL280 RhoplFPRL280|50_12

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|410200
MYLKSPYPDLPEVPDANVYYTHFKRPDQAEWPDFTAFIDATTGQRRRYSEYVKRVEDLATALGTPVSEGGLGLRA
GEGELVGIFSENCMDYITLVHSCLVMTTPFALISSYSTAFELRHALNLTKVTRLFVDAKLLPTLLPVAKEMGIPT
DRIYLLLGDAPGFRSVSELVNHVTEKRIPFIGVQPAKKNTLAYLVLSSGTTGLPKAVMISHGNLSCAFMQFATVV
KVGAEVMPPPTPKGLEGLPTQLAFLPLHHSYGLHQCCFRALILPQTIVILKKWDIKTALDVVQRYKVSSLALVPS
IVHQLVNYPGIEKADLSSVQSSGSGGAYLPPELSTKFSSIIPNANFMEGYGLSEGTIGAINQPFPGSLNGKLKII
PGSIGVLLPGIEARILRDDGTPVKVNEPGEFWFKGGNVALGYLNNDQADKETFVNGWLKTGDKFYVNEEGYLFFA
DRAKDTLKVSGIQVSPVEIENVLLAHPQKLITDVTVAGVSGGRTSDEKVPRAWIVLSPKGEQAGAQTVIKELDNW
HKKNLSKYKWLRGGFEVVTEIPKSPTGKTLRRVLQDQYEGRLRANVKL*
Coding >AgabiH39|410200
ATGTACTTAAAATCCCCATATCCCGATTTACCTGAAGTTCCAGATGCAAATGTTTATTATACGCACTTCAAGCGA
CCTGATCAAGCAGAGTGGCCAGATTTTACAGCGTTTATTGATGCAACGACTGGCCAAAGGAGGAGATATAGCGAA
TATGTCAAGCGGGTCGAAGACCTGGCTACCGCACTCGGAACGCCTGTCTCAGAAGGGGGTCTTGGACTGAGAGCT
GGAGAAGGTGAACTCGTCGGGATCTTCAGCGAGAATTGCATGGATTATATCACTCTTGTCCACTCATGCCTCGTC
ATGACTACTCCATTTGCTCTCATCTCGTCCTACTCAACGGCATTCGAGCTCCGACATGCGTTAAACCTTACAAAA
GTAACCCGTCTTTTCGTTGATGCAAAGCTCCTCCCAACACTTTTGCCTGTTGCCAAAGAAATGGGTATTCCGACA
GATAGAATCTATCTCCTGCTCGGAGATGCGCCCGGATTCAGGAGCGTTTCTGAGCTTGTTAATCACGTCACGGAG
AAGAGGATTCCTTTCATCGGCGTTCAGCCTGCCAAGAAAAATACTCTTGCCTATCTTGTGCTCTCCAGTGGTACC
ACCGGCTTACCGAAAGCTGTAATGATATCTCATGGCAATTTAAGTTGTGCATTTATGCAGTTTGCGACTGTGGTT
AAAGTTGGTGCGGAAGTAATGCCTCCTCCAACACCAAAAGGTTTAGAAGGATTACCCACTCAACTCGCGTTTCTT
CCCTTACACCACAGCTACGGACTTCATCAATGTTGTTTCCGTGCCCTTATTCTCCCCCAAACTATTGTTATTCTT
AAGAAATGGGATATCAAGACTGCATTAGACGTCGTTCAAAGATATAAAGTCTCGAGTCTCGCACTTGTTCCTTCT
ATCGTGCACCAACTTGTAAATTATCCCGGTATTGAAAAGGCTGACCTAAGTAGTGTTCAATCGTCCGGAAGTGGT
GGAGCTTATCTACCACCTGAACTTTCAACCAAATTCTCTTCAATAATTCCCAATGCAAATTTTATGGAAGGTTAC
GGCTTGTCAGAGGGGACCATCGGCGCAATCAATCAACCATTTCCCGGAAGCCTCAATGGCAAATTGAAGATTATT
CCTGGGAGCATAGGTGTCCTTCTTCCCGGAATCGAAGCTCGTATTCTCCGTGATGATGGTACCCCAGTCAAAGTC
AACGAACCAGGAGAATTTTGGTTCAAAGGTGGCAACGTTGCTTTAGGATATCTGAATAATGATCAAGCGGATAAA
GAAACATTTGTAAATGGATGGTTGAAGACGGGAGACAAATTTTATGTGAACGAAGAAGGTTATTTATTCTTCGCG
GATCGCGCTAAGGATACTCTCAAAGTTTCTGGCATTCAAGTGTCTCCCGTCGAAATTGAGAACGTTCTCCTCGCC
CACCCTCAAAAGCTCATCACAGACGTTACGGTCGCTGGTGTTAGTGGCGGACGTACATCGGATGAAAAAGTCCCT
CGTGCTTGGATCGTTCTGAGTCCGAAGGGCGAACAAGCAGGAGCTCAAACTGTCATCAAAGAGCTTGACAATTGG
CACAAGAAGAATTTGAGCAAGTATAAATGGTTGAGGGGAGGTTTTGAGGTTGTTACCGAGATTCCCAAGTCGCCT
ACGGGAAAGACATTACGACGGGTATTACAGGACCAATACGAAGGCCGCCTACGGGCGAATGTTAAATTATGA
Transcript >AgabiH39|410200
ATGTACTTAAAATCCCCATATCCCGATTTACCTGAAGTTCCAGATGCAAATGTTTATTATACGCACTTCAAGCGA
CCTGATCAAGCAGAGTGGCCAGATTTTACAGCGTTTATTGATGCAACGACTGGCCAAAGGAGGAGATATAGCGAA
TATGTCAAGCGGGTCGAAGACCTGGCTACCGCACTCGGAACGCCTGTCTCAGAAGGGGGTCTTGGACTGAGAGCT
GGAGAAGGTGAACTCGTCGGGATCTTCAGCGAGAATTGCATGGATTATATCACTCTTGTCCACTCATGCCTCGTC
ATGACTACTCCATTTGCTCTCATCTCGTCCTACTCAACGGCATTCGAGCTCCGACATGCGTTAAACCTTACAAAA
GTAACCCGTCTTTTCGTTGATGCAAAGCTCCTCCCAACACTTTTGCCTGTTGCCAAAGAAATGGGTATTCCGACA
GATAGAATCTATCTCCTGCTCGGAGATGCGCCCGGATTCAGGAGCGTTTCTGAGCTTGTTAATCACGTCACGGAG
AAGAGGATTCCTTTCATCGGCGTTCAGCCTGCCAAGAAAAATACTCTTGCCTATCTTGTGCTCTCCAGTGGTACC
ACCGGCTTACCGAAAGCTGTAATGATATCTCATGGCAATTTAAGTTGTGCATTTATGCAGTTTGCGACTGTGGTT
AAAGTTGGTGCGGAAGTAATGCCTCCTCCAACACCAAAAGGTTTAGAAGGATTACCCACTCAACTCGCGTTTCTT
CCCTTACACCACAGCTACGGACTTCATCAATGTTGTTTCCGTGCCCTTATTCTCCCCCAAACTATTGTTATTCTT
AAGAAATGGGATATCAAGACTGCATTAGACGTCGTTCAAAGATATAAAGTCTCGAGTCTCGCACTTGTTCCTTCT
ATCGTGCACCAACTTGTAAATTATCCCGGTATTGAAAAGGCTGACCTAAGTAGTGTTCAATCGTCCGGAAGTGGT
GGAGCTTATCTACCACCTGAACTTTCAACCAAATTCTCTTCAATAATTCCCAATGCAAATTTTATGGAAGGTTAC
GGCTTGTCAGAGGGGACCATCGGCGCAATCAATCAACCATTTCCCGGAAGCCTCAATGGCAAATTGAAGATTATT
CCTGGGAGCATAGGTGTCCTTCTTCCCGGAATCGAAGCTCGTATTCTCCGTGATGATGGTACCCCAGTCAAAGTC
AACGAACCAGGAGAATTTTGGTTCAAAGGTGGCAACGTTGCTTTAGGATATCTGAATAATGATCAAGCGGATAAA
GAAACATTTGTAAATGGATGGTTGAAGACGGGAGACAAATTTTATGTGAACGAAGAAGGTTATTTATTCTTCGCG
GATCGCGCTAAGGATACTCTCAAAGTTTCTGGCATTCAAGTGTCTCCCGTCGAAATTGAGAACGTTCTCCTCGCC
CACCCTCAAAAGCTCATCACAGACGTTACGGTCGCTGGTGTTAGTGGCGGACGTACATCGGATGAAAAAGTCCCT
CGTGCTTGGATCGTTCTGAGTCCGAAGGGCGAACAAGCAGGAGCTCAAACTGTCATCAAAGAGCTTGACAATTGG
CACAAGAAGAATTTGAGCAAGTATAAATGGTTGAGGGGAGGTTTTGAGGTTGTTACCGAGATTCCCAAGTCGCCT
ACGGGAAAGACATTACGACGGGTATTACAGGACCAATACGAAGGCCGCCTACGGGCGAATGTTAAATTATGA
Gene >AgabiH39|410200
ATGTACTTAAAATCCCCATATCCCGATTTACCTGAAGTTCCAGATGCAAATGTTTATTATACGCACTTCAAGCGA
CCTGATCAAGCAGAGTGGCCAGATTTTACAGCGTTTATTGATGCAACGACTGGCCAAAGGAGGAGATATAGCGAA
TATGTCAAGCGGGTCGAAGACCTGGCTACCGCACTCGGAACGCCTGTCTCAGAAGGGGGTCTTGGACTGAGAGCT
GGAGAAGGTGAACTCGTCGGGATCTTCAGCGAGAATTGCATGGTACGTTGGAAAATAACCTGTCCCAATTTTCAT
GAACCTTTATCGTTTTTCAGGATTATATCACTCTTGTCCACTCATGCCTCGTCATGACTACTCCATTTGCTCTCA
TCTCGTCCTACTCAACGGCATTCGAGCTCCGACATGCGTTAAACCTTACAAAAGTAACCCGTCTTTTCGTTGATG
CAAAGCTCCTCCCAACACTTTTGCCTGTTGCCAAAGAAATGGGTATTCCGACAGATAGAATCTATCTCCTGCTCG
GAGATGCGCCCGGATTCAGGAGCGTTTCTGAGCTTGTTAATCACGTCACGGAGAAGAGGATTCCTTTCATCGGCG
TTCAGCCTGCCAAGAAAAATACTCTTGCCTATCTTGTGCTCTCCAGTGGTACCACCGGCTTACCGAAAGGTAAGT
TTACATCTTTTATAGGAGATGCCAGCTAACGACCTCTCAGCTGTAATGATATCTCATGGCAATTTAAGTTGTGCA
TTTATGCAGTTTGCGACTGTGGTTAAAGTTGGTGCGGAAGTAATGCCTGTAAGATAAACACTCACTTCTGTGTTG
AATGAATATCGTAACTGACTTGTGTTCAATTCCTCTCCTACATTGATGATACGAACAAAATCATGGAATTTTACA
AGCCTCCAACACCAAAAGGTTTAGAAGGATTACCCACTCAACTCGCGTTTCTTCCCTTACACCACAGCTACGGAC
TTCATCAATGTTGTTTCCGTGCCCTTATTCTCCCCCAAACTATTGTTATTCTTAAGAAATGGGATATCAAGACTG
CATTAGACGTCGTTCAAAGGTAAATACCTACTCTCTTCAACTTAACTTTGTTCTGACCGCTCAACCTCCTCTTTA
CTCGGCGTTGTTCAATGAAGATATAAAGTCTCGAGTCTCGCACTTGTTCCTTCTATCGTGCACCAACTTGTAAAT
TATCCCGGTATTGAAAAGGCTGACCTAAGTAGTGTTCAATCGTCCGGAAGTGGTGGAGCTTATCTACCACCTGAA
CTTTCAACCAAATTCTCTTCAATAATTCCCAATGCAAATTTTATGGAAGGTGAGTGAATTATCATCAGAACAGCG
AAAAGAGACCATTTGCTCATCATGTTATTTCTTGGGCTGTTGGGTATAATAGGTTACGGCTTGTCAGAGGGGGTA
GGTGTCTAACCTGGTTTGCAACGGACGACGTCGGTTGATGATCATCCACGCAGACCATCGGCGCAATCAATCAAC
CATTTCCCGGAAGCCTCAATGGCAAATTGAAGATTATTCCTGGGAGCATAGGTGTCCTTCTTCCCGGAATCGAAG
CTCGTATTCTCCGTGATGATGGTACCCCAGTCAAAGTCAACGAACCAGGAGAATTTTGGTTCAAAGGTGGCAACG
TTGCTTTAGGATATCTGAATAATGATCAAGCGGATAAAGAAACATTTGTAAATGGATGGTTGAAGACGGGAGACA
AATTTTATGTGAACGAAGAAGGTTATTTATTGTACGTCACTTCACTTTTTCACTGGAAAAACTGCGCCAGCTCAT
CCTTGTATGCTCTTCCGTATCGGGTTTTCATCTTCGTAGCTTCGCGGATCGCGCTAAGGTAATTTTACTTTAATT
AATTTAGGACATTCCTGACTGTTGGCCTTTTTAGGATACTCTCAAAGTTTCTGGCATTCAAGTGTCTCCCGTCGA
AATTGAGAACGTTCTCCTCGCCCACCCTCAAAAGCTCATCACAGACGTTACGGTCGCTGGTGTTAGTGGCGGACG
TACATCGGATGAAAAAGTCCCTCGTGCTTGGATCGTTCTGAGTCCGAAGGGCGAACAAGCAGGAGCTCAAACTGT
CATCAAAGAGCTTGACAATTGGCACAAGAAGAATTTGAGCAAGTATAAATGGTTGAGGGGAGGTTTTGAGGTTGT
TACCGAGGTATTTCTATAGAAGCGCTTCATCTCGAATTTTAGGTGGCTGATTGTTTGATAGATTCCCAAGTCGCC
TACGGGAAAGACATTACGACGGGTATTACAGGACCAATACGAAGGCCGCCTACGGGCGAATGTTAAATTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail