Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|378800
Gene name
Locationscaffold_06a:906920..907822
Strand-
Gene length (bp)902
Transcript length (bp)687
Coding sequence length (bp)687
Protein length (aa) 229

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 5.4E-07 2 40
PF00646 F-box F-box domain 7.8E-06 3 39

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup13346
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|378800 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|091220

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|378800
MITSLPSEILVKILVNLGSLELARISGVCRFWKALLENDTYLRCVCFKEPSPYFYVEGCEPILAPGPQDARIRFH
PIIGRVCYQMGEAMSSIRIRDPKNHGPCLTDLTIQDHYATIPRTTRLDIEIISEENQNNRCKTVLPGIKLSISNP
AGIRLRDFFSNIVAETTQMCDLVAYASGGICRQRMQPSLTFLKKAEILGKCKSYAGIESTKISRDGVINVKLCTV
AKL*
Coding >AgabiH39|378800
ATGATCACCTCTCTACCTTCTGAAATTCTTGTCAAAATTCTCGTAAACCTCGGCAGCCTTGAACTCGCCAGGATA
TCTGGTGTTTGTCGATTTTGGAAAGCCCTCCTAGAAAATGATACCTACTTGCGCTGTGTATGCTTCAAGGAGCCC
TCTCCATATTTTTACGTTGAAGGATGCGAACCTATACTGGCGCCAGGCCCTCAAGACGCTCGCATAAGATTCCAC
CCAATTATAGGACGTGTATGTTATCAAATGGGAGAAGCCATGTCTTCTATTCGTATCCGTGACCCCAAGAACCAC
GGTCCTTGTCTTACAGATCTCACTATCCAAGACCATTATGCCACAATCCCTCGCACCACTCGCCTGGATATTGAA
ATTATATCAGAGGAGAATCAAAACAACCGCTGTAAAACAGTCCTTCCAGGGATCAAACTTTCTATATCAAACCCA
GCCGGCATTCGATTACGCGACTTCTTTTCTAACATTGTTGCAGAAACCACACAAATGTGCGATCTGGTCGCTTAT
GCTAGCGGGGGTATTTGCCGTCAACGGATGCAACCTTCTCTCACATTTTTAAAGAAGGCAGAGATTCTGGGGAAA
TGCAAGTCTTATGCAGGCATTGAAAGCACGAAAATCAGTAGAGACGGTGTTATCAACGTCAAGCTATGCACGGTG
GCAAAATTGTGA
Transcript >AgabiH39|378800
ATGATCACCTCTCTACCTTCTGAAATTCTTGTCAAAATTCTCGTAAACCTCGGCAGCCTTGAACTCGCCAGGATA
TCTGGTGTTTGTCGATTTTGGAAAGCCCTCCTAGAAAATGATACCTACTTGCGCTGTGTATGCTTCAAGGAGCCC
TCTCCATATTTTTACGTTGAAGGATGCGAACCTATACTGGCGCCAGGCCCTCAAGACGCTCGCATAAGATTCCAC
CCAATTATAGGACGTGTATGTTATCAAATGGGAGAAGCCATGTCTTCTATTCGTATCCGTGACCCCAAGAACCAC
GGTCCTTGTCTTACAGATCTCACTATCCAAGACCATTATGCCACAATCCCTCGCACCACTCGCCTGGATATTGAA
ATTATATCAGAGGAGAATCAAAACAACCGCTGTAAAACAGTCCTTCCAGGGATCAAACTTTCTATATCAAACCCA
GCCGGCATTCGATTACGCGACTTCTTTTCTAACATTGTTGCAGAAACCACACAAATGTGCGATCTGGTCGCTTAT
GCTAGCGGGGGTATTTGCCGTCAACGGATGCAACCTTCTCTCACATTTTTAAAGAAGGCAGAGATTCTGGGGAAA
TGCAAGTCTTATGCAGGCATTGAAAGCACGAAAATCAGTAGAGACGGTGTTATCAACGTCAAGCTATGCACGGTG
GCAAAATTGTGA
Gene >AgabiH39|378800
ATGATCACCTCTCTACCTTCTGAAATTCTTGTCAAAATTCTCGTAAACCTCGGCAGCCTTGAACTCGCCAGGATA
TCTGGTGTTTGTCGATTTTGGAAAGCCCTCCTAGAAAATGATACCTACTTGCGCTGTGTATGCTTCAAGGAGCCC
TCTCCATATTTTTACGTTGAAGGTATCTCATTCGGCAACTTGCCATTTTATACTGAAGGTTAATCAGCCGTTCTC
AAGGATGCGAACCTATACTGGCGCCAGGCCCTCAAGACGCTCGCATAAGAGTATAGCGTATCTACCTCTTCCTTT
CTCACTCTCTGGCTCAACTTTGCCCCAGTTCCACCCAATTATAGGACGTGTATGTTATCAAATGGGAGAAGCCAT
GTCTTCTATTCGTATCCGTGACCCCAAGAACCACGGTCCTTGTCTTACAGATCTCACTATCCAAGACCATTATGC
CACAATCCCTCGCACCACTCGCCTGGATATTGAAATTATATCAGAGGAGAATCAAAACAACCGCTGTAAAACAGT
CCTTCCAGGGATCAAACTTTCTATATCAAACCCAGCCGGCATTCGATTACGCGACTTCTTTTCTAACATTGTTGC
AGAGTAGGGAAAAGGGTTTATGTCCACTGCTCTCTACTCACATCTCAAATTTTCAGAACCACACAAATGTGCGAT
CTGGTCGCTTATGCTAGCGGGGGTATTTGCCGTCAACGGATGCAACCTTCTCTCACATTTTTAAAGAAGGCAGAG
ATTCTGGGGAAATGCAAGTACGTATTTCACATTCAGGAAAAATTGTATCCTAGTCCAAACACATCCGTAGGTCTT
ATGCAGGCATTGAAAGCACGAAAATCAGTAGAGACGGTGTTATCAACGTCAAGCTATGCACGGTGGCAAAATTGT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail