Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|373300
Gene name
Locationscaffold_06a:484948..489268
Strand-
Gene length (bp)4320
Transcript length (bp)3837
Coding sequence length (bp)3837
Protein length (aa) 1279

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13374 TPR_10 Tetratricopeptide repeat 1.1E-06 771 809
PF13374 TPR_10 Tetratricopeptide repeat 2.2E-09 810 851
PF13374 TPR_10 Tetratricopeptide repeat 3.0E-11 852 893
PF13374 TPR_10 Tetratricopeptide repeat 5.3E-11 894 935
PF13374 TPR_10 Tetratricopeptide repeat 1.1E-12 936 977
PF13374 TPR_10 Tetratricopeptide repeat 1.6E-08 978 1019
PF13374 TPR_10 Tetratricopeptide repeat 1.8E-09 1020 1061
PF13374 TPR_10 Tetratricopeptide repeat 9.0E-09 1062 1103
PF13374 TPR_10 Tetratricopeptide repeat 1.0E-06 1104 1145
PF13374 TPR_10 Tetratricopeptide repeat 5.3E-12 1146 1187
PF13374 TPR_10 Tetratricopeptide repeat 8.4E-12 1188 1229
PF13374 TPR_10 Tetratricopeptide repeat 3.2E-08 1230 1268
PF13424 TPR_12 Tetratricopeptide repeat 5.0E-11 770 831
PF13424 TPR_12 Tetratricopeptide repeat 1.9E-11 942 1000
PF01734 Patatin Patatin-like phospholipase 4.5E-22 25 227
PF07721 TPR_4 Tetratricopeptide repeat 2.7E-01 770 791
PF00931 NB-ARC NB-ARC domain 2.0E-06 404 618

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 888 1181 3.0E-31
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 771 1074 6.0E-31
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 892 1181 9.0E-31
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 887 1179 2.0E-30
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 934 1273 2.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 888 1181 3.0E-31
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 771 1074 6.0E-31
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 892 1181 9.0E-31
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 887 1179 2.0E-30
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 934 1273 2.0E-30
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 888 1178 3.0E-30
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 888 1194 8.0E-30
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 930 1236 9.0E-30
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 803 1116 1.0E-29
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 892 1194 1.0E-29
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 934 1236 2.0E-29
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 888 1237 3.0E-29
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 888 1236 3.0E-29
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 892 1195 5.0E-29
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1013 1263 7.0E-29
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 771 1053 7.0E-29
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 771 1055 8.0E-29
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 771 1068 8.0E-29
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 796 1102 8.0E-29
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 771 1068 9.0E-29
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 892 1195 1.0E-28
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 971 1221 2.0E-28
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 925 1221 2.0E-28
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 934 1221 2.0E-28
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 771 1055 4.0E-28
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 808 1097 5.0E-28
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 796 1102 5.0E-28
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 853 1217 8.0E-28
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1014 1265 1.0E-27
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 771 1053 1.0E-27
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 771 1053 1.0E-27
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 930 1221 1.0E-27
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 771 1068 2.0E-27
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1009 1263 3.0E-27
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1014 1265 3.0E-27
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1018 1265 5.0E-27
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 853 1228 5.0E-27
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 897 1228 6.0E-27
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 888 1195 6.0E-27
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 1018 1263 7.0E-27
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 897 1228 7.0E-27
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 888 1194 7.0E-27
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 1018 1263 8.0E-27
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 841 1136 9.0E-27
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 804 1095 1.0E-26
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 930 1236 1.0E-26
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 796 1091 2.0E-26
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1014 1265 3.0E-26
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 1009 1275 5.0E-26
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 752 1068 6.0E-26
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1056 1278 9.0E-26
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1060 1278 1.0E-25
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 771 1055 1.0E-25
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1056 1278 1.0E-25
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 771 1053 1.0E-25
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 796 1091 1.0E-25
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 888 1237 1.0E-25
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 804 1097 2.0E-25
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 841 1181 2.0E-25
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 976 1221 2.0E-25
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 771 1053 2.0E-25
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 851 1217 2.0E-25
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1014 1275 7.0E-25
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 1014 1263 9.0E-25
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 1014 1263 1.0E-24
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 763 1011 3.0E-24
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 796 1091 3.0E-24
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 939 1253 4.0E-24
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 1014 1265 4.0E-24
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 736 1149 6.0E-24
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 771 1055 6.0E-24
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 898 1259 8.0E-24
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 972 1221 1.0E-23
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 981 1253 2.0E-23
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 804 1009 2.0E-23
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 772 1060 3.0E-23
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 763 1013 5.0E-23
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 751 1049 5.0E-23
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 892 1092 5.0E-23
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 892 1085 5.0E-23
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 898 1259 6.0E-23
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 892 1092 6.0E-23
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 892 1092 6.0E-23
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 892 1085 7.0E-23
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 940 1266 1.0E-22
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 763 1011 2.0E-22
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 841 1051 2.0E-22
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 939 1259 2.0E-22
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 771 959 3.0E-22
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 771 966 4.0E-22
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1018 1211 4.0E-22
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 771 966 5.0E-22
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 771 966 5.0E-22
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 771 959 6.0E-22
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 12 344 6.0E-22
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1018 1224 7.0E-22
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 763 1027 9.0E-22
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 751 1049 9.0E-22
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1018 1218 9.0E-22
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1018 1224 9.0E-22
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1018 1218 1.0E-21
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 934 1149 2.0E-21
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 934 1149 2.0E-21
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 934 1149 2.0E-21
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1060 1260 3.0E-21
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1060 1260 4.0E-21
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1060 1253 4.0E-21
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 976 1176 4.0E-21
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1060 1260 5.0E-21
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 976 1169 6.0E-21
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1060 1253 6.0E-21
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 850 1078 7.0E-21
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 976 1176 7.0E-21
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 808 1039 7.0E-21
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 934 1137 8.0E-21
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 850 1078 8.0E-21
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 976 1176 8.0E-21
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 808 1001 9.0E-21
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 976 1169 9.0E-21
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1097 1268 1.0E-20
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 763 1036 1.0E-20
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 808 1008 1.0E-20
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 808 1008 1.0E-20
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 934 1137 1.0E-20
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 808 1001 1.0E-20
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 12 344 1.0E-20
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 850 1050 2.0E-20
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 12 344 2.0E-20
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1098 1268 3.0E-20
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 751 1049 3.0E-20
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 850 1043 3.0E-20
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 850 1043 4.0E-20
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1093 1268 7.0E-20
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 763 1027 1.0E-19
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 763 1013 2.0E-19
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 748 965 1.0E-18
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 763 1013 3.0E-18
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 1102 1268 6.0E-18
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 731 1023 7.0E-18
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 22 319 8.0E-18
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 743 976 1.0E-16
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 772 1023 1.0E-15
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 770 917 2.0E-15
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 759 924 3.0E-15
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 770 930 3.0E-15
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 759 924 3.0E-15
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 770 930 3.0E-15
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1144 1268 7.0E-14
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1144 1268 9.0E-14
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1144 1268 1.0E-13
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1144 1268 1.0E-13
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1144 1268 1.0E-13
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 1140 1268 5.0E-13
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 1140 1268 5.0E-12
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 1087 1268 8.0E-12
sp|O23180|PLP5_ARATH Patatin-like protein 5 OS=Arabidopsis thaliana GN=PLP5 PE=1 SV=2 19 322 3.0E-11
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 1087 1268 4.0E-11
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 1019 1268 1.0E-10
sp|O48723|PLP2_ARATH Patatin-like protein 2 OS=Arabidopsis thaliana GN=PLP2 PE=1 SV=1 22 305 1.0E-10
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 1019 1268 2.0E-10
sp|B8AQW7|PLP1_ORYSI Patatin-like protein 1 OS=Oryza sativa subsp. indica GN=PLP1 PE=3 SV=1 12 232 3.0E-09
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 1020 1268 6.0E-09
sp|O23179|PLP1_ARATH Patatin-like protein 1 OS=Arabidopsis thaliana GN=PLP1 PE=1 SV=2 19 323 6.0E-09
sp|Q93ZQ3|PLP9_ARATH Probable inactive patatin-like protein 9 OS=Arabidopsis thaliana GN=PLP9 PE=2 SV=1 23 228 8.0E-07
sp|Q9FIY1|PLP4_ARATH Patatin-like protein 4 OS=Arabidopsis thaliana GN=PLP4 PE=3 SV=1 71 305 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0042802 identical protein binding Yes
GO:0006629 lipid metabolic process Yes
GO:0043531 ADP binding Yes
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0036094 small molecule binding No
GO:0044238 primary metabolic process No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0005515 protein binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0032555 purine ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup243
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016000
Agaricus bisporus var bisporus H39 AgabiH39|474700
Agaricus bisporus var bisporus H39 AgabiH39|447800
Agaricus bisporus var bisporus H39 AgabiH39|447100
Agaricus bisporus var bisporus H39 AgabiH39|373300 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|481100
Agaricus bisporus var bisporus H39 AgabiH39|281600
Agaricus bisporus var bisporus H39 AgabiH39|278300
Agaricus bisporus var bisporus H39 AgabiH39|053070
Agaricus bisporus var bisporus H39 AgabiH39|371700
Agaricus bisporus var bisporus H97 AgabiH97|109720
Agaricus bisporus var bisporus H97 AgabiH97|016000
Agaricus bisporus var bisporus H97 AgabiH97|016120
Agaricus bisporus var bisporus H97 AgabiH97|020470
Agaricus bisporus var bisporus H97 AgabiH97|052840
Agaricus bisporus var bisporus H97 AgabiH97|052910
Agaricus bisporus var bisporus H97 AgabiH97|053070
Agaricus bisporus var bisporus H97 AgabiH97|054350
Agaricus bisporus var bisporus H97 AgabiH97|089750
Agaricus bisporus var bisporus H97 AgabiH97|109860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|373300
MHRMSSSTRNSGSRSTLEGPPLRLLALDGGGIRGLSELLILKEVMHKLMFEENEKRKKDGEEPLSALPKPCDYFD
LIGGTSTGGIIALMLGRLRMDVDTAIKNYDDLAKQVFSAMKLWGDGKFKATTLEAAMKSVVKTVTGDSESPLLEG
DQAGVCRTFVCAKNAHNLYIPVLFRTYQSSETHSNCKIWEAARATSAAPTFFKRVIIGRDQPFIDGGLGRNNPSQ
VVLEEASVLFGARQIGCLVSIGTGQAEVNEIKKPGLWQQILPTDVIDALKRITTDCESTHEDVLRRFSKLPNTYF
RLNVDQGMQGIELSEWEKLSNVEAHTMQYMRKEEVVGRLALLVSAIRDPRGQLPLEQLITPTPPKELVPQVRERK
RCPLPVQPFMGREEILDKMRRYFEVGGDSRRVFVLHGLGGSGKTQIAFKFVQESTCFSDVFYIDATNEQTLRTDL
EAITPGNTEQSVHASLHWLASQRERNWLLFFDNADDVNLKLNEFIPQCRSGNILVTTRNHELRLLSAKDGDAKVG
AMEHEDATNLLLDRARAEESDENKVLAEAIVQELHYFALAISQAGAYIHCRLSLGEYREFYRRHHDKLLQNKEFQ
GEDPYERAVYATWSLSYEKLDAPARSLLQIFSMLNHEGISEEMFEKAASSEEQLEDPELQNKVNELLNKLGKRGP
GWSWDFKQVIEHLRSYSLIEYDARNHTYSIHPLVQQWSRSTMEGNRQLIQKCVLSIIGLSISWTFDDQGYRYRRT
LLQHISSSRASVDLEQTTPSVLSGLALVYFEQGQWKEAEALRVVVMEKRKRLLGDDHPHTLTSMSNLASTYGDQG
KWNKAEVLQVVVMEKSKQLFGDDHPHTLTSMANLATTYGKRGQWKEAEALQVVVMEKRKRLLGDDHPHTLTSMAN
LAATYWNQGQWNKAEALEVVVMEKSKQLLGDDHPDTLMSMANLATTYRNQGQWKEAEALQVVVMEKRKRLLGDDH
PHTLTSMANLATTYRKQGQWKESEALRVVVMEKSKQLLGDDHPDTLTSLSNLASTYGDQGKWNKAEVLQVVVMEK
SKQLLGDDHPHTLMSMSNLASTYGDQEQWNKAEVLQVVVMEKSKQLLGDDHPHTLMSMSNLASTYGDQGKWKESE
TLRVVVMEKSKLLLGDDHPDTLTSLSNLASTYGDQGKWNEAEALQVVVMEKRKRLLGDDHPHTLTSMANLASTYR
DQGKWNEAEALEVVVMEKRKQLLGDDHPHTLTNMTNLASTYRNQGQWKEAEALQVVVMEKRKQLLGDDLNTEVLQ
HRE*
Coding >AgabiH39|373300
ATGCATAGGATGTCATCTAGCACAAGGAACTCGGGATCCCGATCAACTTTAGAAGGACCACCTTTGAGGCTGCTT
GCGCTAGATGGCGGTGGGATTCGTGGACTTTCAGAACTACTCATTCTCAAAGAAGTTATGCACAAGCTGATGTTT
GAGGAGAACGAGAAACGGAAGAAGGACGGCGAAGAACCTCTTAGCGCACTCCCGAAGCCGTGCGATTACTTCGAT
CTGATTGGTGGTACTAGTACTGGAGGGATAATTGCTTTAATGCTTGGGCGTCTTCGGATGGATGTAGACACGGCA
ATAAAAAACTATGATGATCTGGCAAAACAAGTCTTCTCTGCTATGAAGCTATGGGGAGACGGAAAATTCAAAGCG
ACAACACTCGAAGCAGCCATGAAATCTGTCGTGAAGACCGTAACTGGTGATTCAGAGTCACCCTTATTAGAGGGT
GACCAAGCTGGAGTCTGCCGGACTTTCGTCTGTGCAAAGAACGCCCACAACCTGTACATTCCAGTGCTTTTCAGG
ACATACCAGTCTAGTGAAACGCATTCAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACGTCTGCAGCACCTACA
TTTTTTAAGCGCGTTATAATTGGGCGGGACCAACCCTTTATCGATGGCGGACTAGGTCGCAATAATCCGAGTCAG
GTGGTACTGGAGGAAGCCAGTGTTCTATTTGGTGCTCGTCAAATCGGGTGCTTGGTGAGCATTGGCACCGGACAG
GCCGAAGTAAATGAGATCAAGAAACCTGGGCTATGGCAACAAATTTTACCGACCGACGTCATTGATGCGTTAAAA
AGAATAACCACCGACTGCGAATCAACACACGAAGATGTGTTGCGTCGTTTCTCCAAGTTGCCGAACACCTACTTT
CGACTAAATGTCGACCAGGGAATGCAGGGAATAGAACTTTCCGAATGGGAGAAACTGAGCAATGTGGAGGCTCAT
ACAATGCAATATATGAGGAAGGAGGAGGTCGTTGGGAGGCTTGCCTTGTTGGTTAGTGCGATCAGAGACCCGAGA
GGGCAGCTTCCACTCGAGCAACTCATTACCCCTACGCCTCCAAAGGAATTGGTCCCACAAGTTAGGGAACGAAAG
CGTTGTCCGCTTCCTGTGCAACCATTCATGGGACGAGAGGAAATCCTTGATAAGATGCGCAGATATTTTGAGGTG
GGGGGTGATTCTCGACGCGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTTTCAAATTT
GTGCAAGAATCAACCTGCTTCTCCGACGTCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACAGACCTT
GAGGCCATCACTCCAGGAAATACAGAGCAATCAGTACATGCGAGTCTCCATTGGCTTGCAAGCCAGCGCGAGAGG
AACTGGCTTCTCTTCTTCGACAACGCGGATGATGTGAACTTGAAACTGAATGAATTCATTCCTCAGTGTCGATCT
GGAAACATCCTGGTTACAACACGTAACCATGAGCTTCGCCTTCTCTCTGCGAAAGACGGGGATGCAAAAGTTGGT
GCGATGGAGCACGAAGACGCAACAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGCGATGAAAATAAAGTG
CTGGCAGAGGCAATTGTACAGGAACTCCATTACTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTACATTCATTGC
CGCTTGTCATTAGGCGAATACCGAGAATTCTATCGACGTCACCACGACAAACTGTTACAGAATAAAGAGTTCCAA
GGAGAAGATCCATACGAACGAGCGGTGTATGCGACGTGGAGTTTGAGCTACGAGAAACTTGACGCGCCAGCGAGA
TCTTTGCTCCAAATTTTCTCCATGCTAAATCACGAAGGAATCTCGGAGGAAATGTTCGAAAAGGCGGCATCGTCT
GAAGAGCAACTGGAGGATCCCGAACTACAAAACAAAGTGAATGAGTTGTTGAACAAGCTGGGAAAACGAGGTCCG
GGTTGGTCTTGGGATTTTAAGCAGGTCATCGAGCACCTTCGTTCATATTCGCTCATTGAATATGATGCTCGAAAT
CACACCTACAGCATTCATCCACTAGTACAACAGTGGAGTCGTAGCACCATGGAAGGAAACAGGCAGCTCATACAG
AAATGCGTACTCAGCATCATTGGCCTATCAATTTCTTGGACATTCGACGACCAGGGCTACAGGTATCGACGCACA
CTTTTGCAGCATATCTCTAGCTCCAGAGCCTCGGTTGATCTAGAACAGACGACGCCTTCGGTTTTGAGTGGTTTG
GCGCTTGTGTACTTTGAACAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCGGGTGGTGGTGATGGAGAAGAGGAAG
CGGCTGCTCGGTGATGATCATCCTCACACGCTCACAAGCATGTCCAATCTTGCGTCTACGTACGGGGACCAGGGG
AAGTGGAACAAAGCAGAGGTACTTCAGGTGGTGGTGATGGAGAAGAGCAAGCAGCTGTTCGGTGATGATCATCCT
CACACGCTCACAAGCATGGCCAATCTTGCGACCACATACGGGAAACGGGGGCAGTGGAAGGAAGCAGAGGCGCTT
CAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCATCCTCACACGCTCACAAGCATGGCCAAT
CTTGCGGCCACATACTGGAACCAGGGGCAGTGGAACAAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGC
AAGCAGCTGCTTGGTGATGATCATCCTGACACACTCATGAGCATGGCCAATCTTGCGACCACATACAGGAACCAG
GGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCAT
CCTCATACGCTCACGAGCATGGCCAATCTTGCGACCACATACAGGAAACAGGGGCAGTGGAAGGAATCAGAGGCG
CTTCGGGTGGTGGTGATGGAGAAGAGCAAGCAGCTGCTCGGTGATGATCATCCTGACACGCTCACAAGCCTGTCC
AATCTTGCATCTACGTACGGGGACCAGGGGAAGTGGAACAAAGCAGAGGTACTTCAGGTGGTGGTGATGGAGAAG
AGCAAGCAGCTGCTTGGTGATGATCATCCTCACACACTCATGAGTATGTCCAATCTTGCGTCTACGTACGGGGAC
CAGGAGCAGTGGAACAAAGCAGAGGTACTTCAGGTGGTGGTGATGGAAAAGAGCAAGCAGCTGCTTGGTGATGAT
CATCCTCATACGCTCATGAGCATGTCCAATCTTGCGTCTACGTATGGGGACCAGGGGAAGTGGAAGGAATCAGAG
ACGCTTCGGGTGGTGGTGATGGAGAAGAGCAAGCTGCTGCTCGGTGATGATCATCCTGACACGCTCACAAGCCTG
TCCAATCTTGCGTCTACGTACGGGGACCAGGGGAAGTGGAATGAAGCAGAGGCACTTCAGGTGGTGGTGATGGAG
AAGAGGAAGCGGCTGCTTGGTGATGATCATCCTCATACGCTCACGAGCATGGCCAATCTTGCGTCTACGTACAGG
GACCAGGGGAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCAGCTGCTCGGTGAT
GATCATCCTCACACGCTCACAAACATGACCAATCTTGCGTCCACGTACAGAAACCAGGGGCAGTGGAAGGAAGCA
GAGGCGCTTCAGGTGGTGGTGATGGAGAAGAGGAAACAGCTGCTTGGTGATGATTTGAATACTGAAGTGCTTCAA
CACCGGGAGTGA
Transcript >AgabiH39|373300
ATGCATAGGATGTCATCTAGCACAAGGAACTCGGGATCCCGATCAACTTTAGAAGGACCACCTTTGAGGCTGCTT
GCGCTAGATGGCGGTGGGATTCGTGGACTTTCAGAACTACTCATTCTCAAAGAAGTTATGCACAAGCTGATGTTT
GAGGAGAACGAGAAACGGAAGAAGGACGGCGAAGAACCTCTTAGCGCACTCCCGAAGCCGTGCGATTACTTCGAT
CTGATTGGTGGTACTAGTACTGGAGGGATAATTGCTTTAATGCTTGGGCGTCTTCGGATGGATGTAGACACGGCA
ATAAAAAACTATGATGATCTGGCAAAACAAGTCTTCTCTGCTATGAAGCTATGGGGAGACGGAAAATTCAAAGCG
ACAACACTCGAAGCAGCCATGAAATCTGTCGTGAAGACCGTAACTGGTGATTCAGAGTCACCCTTATTAGAGGGT
GACCAAGCTGGAGTCTGCCGGACTTTCGTCTGTGCAAAGAACGCCCACAACCTGTACATTCCAGTGCTTTTCAGG
ACATACCAGTCTAGTGAAACGCATTCAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACGTCTGCAGCACCTACA
TTTTTTAAGCGCGTTATAATTGGGCGGGACCAACCCTTTATCGATGGCGGACTAGGTCGCAATAATCCGAGTCAG
GTGGTACTGGAGGAAGCCAGTGTTCTATTTGGTGCTCGTCAAATCGGGTGCTTGGTGAGCATTGGCACCGGACAG
GCCGAAGTAAATGAGATCAAGAAACCTGGGCTATGGCAACAAATTTTACCGACCGACGTCATTGATGCGTTAAAA
AGAATAACCACCGACTGCGAATCAACACACGAAGATGTGTTGCGTCGTTTCTCCAAGTTGCCGAACACCTACTTT
CGACTAAATGTCGACCAGGGAATGCAGGGAATAGAACTTTCCGAATGGGAGAAACTGAGCAATGTGGAGGCTCAT
ACAATGCAATATATGAGGAAGGAGGAGGTCGTTGGGAGGCTTGCCTTGTTGGTTAGTGCGATCAGAGACCCGAGA
GGGCAGCTTCCACTCGAGCAACTCATTACCCCTACGCCTCCAAAGGAATTGGTCCCACAAGTTAGGGAACGAAAG
CGTTGTCCGCTTCCTGTGCAACCATTCATGGGACGAGAGGAAATCCTTGATAAGATGCGCAGATATTTTGAGGTG
GGGGGTGATTCTCGACGCGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTTTCAAATTT
GTGCAAGAATCAACCTGCTTCTCCGACGTCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACAGACCTT
GAGGCCATCACTCCAGGAAATACAGAGCAATCAGTACATGCGAGTCTCCATTGGCTTGCAAGCCAGCGCGAGAGG
AACTGGCTTCTCTTCTTCGACAACGCGGATGATGTGAACTTGAAACTGAATGAATTCATTCCTCAGTGTCGATCT
GGAAACATCCTGGTTACAACACGTAACCATGAGCTTCGCCTTCTCTCTGCGAAAGACGGGGATGCAAAAGTTGGT
GCGATGGAGCACGAAGACGCAACAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGCGATGAAAATAAAGTG
CTGGCAGAGGCAATTGTACAGGAACTCCATTACTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTACATTCATTGC
CGCTTGTCATTAGGCGAATACCGAGAATTCTATCGACGTCACCACGACAAACTGTTACAGAATAAAGAGTTCCAA
GGAGAAGATCCATACGAACGAGCGGTGTATGCGACGTGGAGTTTGAGCTACGAGAAACTTGACGCGCCAGCGAGA
TCTTTGCTCCAAATTTTCTCCATGCTAAATCACGAAGGAATCTCGGAGGAAATGTTCGAAAAGGCGGCATCGTCT
GAAGAGCAACTGGAGGATCCCGAACTACAAAACAAAGTGAATGAGTTGTTGAACAAGCTGGGAAAACGAGGTCCG
GGTTGGTCTTGGGATTTTAAGCAGGTCATCGAGCACCTTCGTTCATATTCGCTCATTGAATATGATGCTCGAAAT
CACACCTACAGCATTCATCCACTAGTACAACAGTGGAGTCGTAGCACCATGGAAGGAAACAGGCAGCTCATACAG
AAATGCGTACTCAGCATCATTGGCCTATCAATTTCTTGGACATTCGACGACCAGGGCTACAGGTATCGACGCACA
CTTTTGCAGCATATCTCTAGCTCCAGAGCCTCGGTTGATCTAGAACAGACGACGCCTTCGGTTTTGAGTGGTTTG
GCGCTTGTGTACTTTGAACAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCGGGTGGTGGTGATGGAGAAGAGGAAG
CGGCTGCTCGGTGATGATCATCCTCACACGCTCACAAGCATGTCCAATCTTGCGTCTACGTACGGGGACCAGGGG
AAGTGGAACAAAGCAGAGGTACTTCAGGTGGTGGTGATGGAGAAGAGCAAGCAGCTGTTCGGTGATGATCATCCT
CACACGCTCACAAGCATGGCCAATCTTGCGACCACATACGGGAAACGGGGGCAGTGGAAGGAAGCAGAGGCGCTT
CAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCATCCTCACACGCTCACAAGCATGGCCAAT
CTTGCGGCCACATACTGGAACCAGGGGCAGTGGAACAAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGC
AAGCAGCTGCTTGGTGATGATCATCCTGACACACTCATGAGCATGGCCAATCTTGCGACCACATACAGGAACCAG
GGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCAT
CCTCATACGCTCACGAGCATGGCCAATCTTGCGACCACATACAGGAAACAGGGGCAGTGGAAGGAATCAGAGGCG
CTTCGGGTGGTGGTGATGGAGAAGAGCAAGCAGCTGCTCGGTGATGATCATCCTGACACGCTCACAAGCCTGTCC
AATCTTGCATCTACGTACGGGGACCAGGGGAAGTGGAACAAAGCAGAGGTACTTCAGGTGGTGGTGATGGAGAAG
AGCAAGCAGCTGCTTGGTGATGATCATCCTCACACACTCATGAGTATGTCCAATCTTGCGTCTACGTACGGGGAC
CAGGAGCAGTGGAACAAAGCAGAGGTACTTCAGGTGGTGGTGATGGAAAAGAGCAAGCAGCTGCTTGGTGATGAT
CATCCTCATACGCTCATGAGCATGTCCAATCTTGCGTCTACGTATGGGGACCAGGGGAAGTGGAAGGAATCAGAG
ACGCTTCGGGTGGTGGTGATGGAGAAGAGCAAGCTGCTGCTCGGTGATGATCATCCTGACACGCTCACAAGCCTG
TCCAATCTTGCGTCTACGTACGGGGACCAGGGGAAGTGGAATGAAGCAGAGGCACTTCAGGTGGTGGTGATGGAG
AAGAGGAAGCGGCTGCTTGGTGATGATCATCCTCATACGCTCACGAGCATGGCCAATCTTGCGTCTACGTACAGG
GACCAGGGGAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCAGCTGCTCGGTGAT
GATCATCCTCACACGCTCACAAACATGACCAATCTTGCGTCCACGTACAGAAACCAGGGGCAGTGGAAGGAAGCA
GAGGCGCTTCAGGTGGTGGTGATGGAGAAGAGGAAACAGCTGCTTGGTGATGATTTGAATACTGAAGTGCTTCAA
CACCGGGAGTGA
Gene >AgabiH39|373300
ATGCATAGGATGTCATCTAGCACAAGGAACTCGGGATCCCGATCAACGTTCGGGGCCCCCTTTCGCTTCTCAATA
ACCAGTTATCGCAGCAAACAGTACTAGGCCTTTCCGTGAGAAAGTTTAGGTGCGTCCATACAGCATGTCATATCT
CACAGCCTCTCCTTGGTCTTAACAATGACTTCTTCTGCAGAAGGACCACCTTTGAGGCTGCTTGCGCTAGGTATG
TACGTCTGTTTGCACTCTCTCACCGATAGAGTCGCTAACTAGTGACCTCTGAACAGATGGCGGTGGGATTCGTGG
ACTTTCAGAACTACTCATTCTCAAAGAAGTTATGCACAAGCTGATGTTTGAGGAGAACGAGAAACGGAAGAAGGA
CGGCGAAGAACCTCTTAGCGCACTCCCGAAGCCGTGCGATTACTTCGATCTGATTGGTGGTACTAGTACTGGAGG
GTGCGTTGAGTTATGCATCTACAATCGTCTCATGTTACTCACATGTATATTACAGGATAATTGCTTTAATGCTTG
GGCGTCTTCGGATGGATGTAGACACGGCAATAAAAAACTATGATGATCTGGCAAAACAAGTCTTCTCTGCTATGA
AGCTATGGGGAGACGGAAAATTCAAAGCGACAACACTCGAAGCAGCCATGAAATCTGTCGTGAAGACCGTAACTG
GTGATTCAGAGTCACCCTTATTAGAGGGTGACCAAGCTGGAGTCTGCCGGACGTGAGTATATTACCTACTCTTCC
ATGCGTTTGGACTTTGAATTCGAAGATTTATTAGTTTCGTCTGTGCAAAGAACGCCCACAACCTGTACATTCCAG
TGCTTTTCAGGACATACCAGTCTAGTGAAACGCATTCAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACGTCTG
CAGCACCTACATTTTTTAAGCGCGTTATAATTGGGCGGGACCAACCCTTTATCGATGGCGGACTAGGTCGCAATA
ATCCGAGTCAGGTGGTACTGGAGGAAGCCAGTGTTCTATTTGGTGCTCGTCAAATCGGGTGCTTGGTGAGCATTG
GCACCGGACAGGCCGAAGTAAATGAGATCAAGAAACCTGGGCTATGGCAACAAATTTTACCGACCGACGTCATTG
ATGCGTTAAAAAGAATAACCACCGACTGCGAATCAACACACGAAGATGTGTTGCGTCGTTTCTCCAAGTTGCCGA
ACACCTACTTTCGACTAAATGTCGACCAGGGAATGCAGGGAATAGAACTTTCCGAATGGGAGAAACTGAGCAATG
TGGAGGCTCATACAATGCAATATATGAGGAAGGAGGAGGTCGTTGGGAGGCTTGCCTTGTTGGTTAGTGCGATCA
GAGACCCGAGAGGGCAGCTTCCACTCGAGCAACTCAGTATGGAAAAATTGCTCTTGTAGATCTTCATAATAATCT
AATCTCGTTACCCTAGTTACCCCTACGCCTCCAAAGGAATTGGTCCCACAAGTTAGGGAACGAAAGCGTTGTCCG
CTTCCTGTGCAACCATTCATGGGACGAGAGGAAATCCTTGATAAGATGCGCAGATATTTTGAGGTGGGGGGTGAT
TCTCGACGCGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTTTCAAATTTGTGCAAGAA
TCAACCTGGTATGATCCTACTCTCTACAAATTTGCGACTGGCGACAATTTATTTGTTTTATTTCCAGCTTCTCCG
ACGTCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACAGACCTTGAGGCCATCACTCCAGGAAATACAG
AGCAATCAGTACATGCGAGTCTCCATTGGCTTGCAAGCCAGCGCGAGAGGAACTGGCTTCTCTTCTTCGACAACG
CGGATGATGTGAACTTGAAACTGAATGAATTCATTCCTCAGTGTCGATCTGGAAACATCCTGGTTACAACACGTA
ACCATGAGCTTCGCCTTCTCTCTGCGAAAGACGGGGATGCAAAAGTTGGTGCGATGGAGCACGAAGACGCAACAA
ACCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGCGATGAAAATAAAGTGCTGGCAGAGGCAATTGTACAGGTTC
GTCCTTTCATTTTCGTTTCTTTAGAAAACACTTTGAGTCTGAAGCACGAGACAGGAACTCCATTACTTTGCTTTG
GCTATTTCCCAAGCTGGCGCTTACATTCATTGCCGCTTGTCATTAGGCGAATACCGAGAATTCTATCGACGTCAC
CACGACAAACTGTTACAGAATAAAGAGTTCCAAGGAGAAGATCCATACGAACGAGCGGTGTATGCGACGTGGAGT
TTGAGCTACGAGAAACTTGACGCGCCAGCGAGATCTTTGCTCCAAATTTTCTCCATGCTAAATCACGAAGGAATC
TCGGAGGAAATGTTCGAAAAGGCGGCATCGTCTGAAGAGCAACTGGAGGATCCCGAACTACAAAACAAAGTGAAT
GAGTTGTTGAACAAGCTGGGAAAACGAGGTCCGGGTTGGTCTTGGGATTTTAAGCAGGTCATCGAGCACCTTCGT
TCATATTCGCTCATTGAATATGATGCTCGAAATCACACCTACAGCATTCATCCACTAGTACAACAGTGGAGTCGT
AGCACCATGGAAGGAAACAGGCAGCTCATACAGAAATGCGTACTCAGCATCATTGGCCTATCAATTTCTTGGACA
TTCGACGACCAGGGCTACAGGTATCGACGCACACTTTTGCAGCATATCTCTAGCTCCAGAGCCTCGGTTGATCTA
GAACAGACGACGCCTTCGGTTTTGAGTGGTTTGGCGCTTGTGTACTTTGAACAGGGGCAGTGGAAGGAAGCAGAG
GCGCTTCGGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCATCCTCACACGCTCACAAGCATG
TCCAATCTTGCGTCTACGTACGGGGACCAGGGGAAGTGGAACAAAGCAGAGGTACTTCAGGTGGTGGTGATGGAG
AAGAGCAAGCAGCTGTTCGGTGATGATCATCCTCACACGCTCACAAGCATGGCCAATCTTGCGACCACATACGGG
AAACGGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGAT
GATCATCCTCACACGCTCACAAGCATGGCCAATCTTGCGGCCACATACTGGAACCAGGGGCAGTGGAACAAAGCA
GAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGCAAGCAGCTGCTTGGTGATGATCATCCTGACACACTCATGAGC
ATGGCCAATCTTGCGACCACATACAGGAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATG
GAGAAGAGGAAGCGGCTGCTCGGTGATGATCATCCTCATACGCTCACGAGCATGGCCAATCTTGCGACCACATAC
AGGAAACAGGGGCAGTGGAAGGAATCAGAGGCGCTTCGGGTGGTGGTGATGGAGAAGAGCAAGCAGCTGCTCGGT
GATGATCATCCTGACACGCTCACAAGCCTGTCCAATCTTGCATCTACGTACGGGGACCAGGGGAAGTGGAACAAA
GCAGAGGTACTTCAGGTGGTGGTGATGGAGAAGAGCAAGCAGCTGCTTGGTGATGATCATCCTCACACACTCATG
AGTATGTCCAATCTTGCGTCTACGTACGGGGACCAGGAGCAGTGGAACAAAGCAGAGGTACTTCAGGTGGTGGTG
ATGGAAAAGAGCAAGCAGCTGCTTGGTGATGATCATCCTCATACGCTCATGAGCATGTCCAATCTTGCGTCTACG
TATGGGGACCAGGGGAAGTGGAAGGAATCAGAGACGCTTCGGGTGGTGGTGATGGAGAAGAGCAAGCTGCTGCTC
GGTGATGATCATCCTGACACGCTCACAAGCCTGTCCAATCTTGCGTCTACGTACGGGGACCAGGGGAAGTGGAAT
GAAGCAGAGGCACTTCAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTTGGTGATGATCATCCTCATACGCTC
ACGAGCATGGCCAATCTTGCGTCTACGTACAGGGACCAGGGGAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTG
GTGATGGAGAAGAGGAAGCAGCTGCTCGGTGATGATCATCCTCACACGCTCACAAACATGACCAATCTTGCGTCC
ACGTACAGAAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGAGGAAACAGCTG
CTTGGTGATGATTTGAATACTGAAGTGCTTCAACACCGGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail