Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|371700
Gene name
Locationscaffold_06a:434993..438905
Strand+
Gene length (bp)3912
Transcript length (bp)3303
Coding sequence length (bp)3303
Protein length (aa) 1101

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13374 TPR_10 Tetratricopeptide repeat 6.8E-08 771 809
PF13374 TPR_10 Tetratricopeptide repeat 1.9E-12 810 851
PF13374 TPR_10 Tetratricopeptide repeat 5.9E-12 852 893
PF13374 TPR_10 Tetratricopeptide repeat 5.2E-12 894 935
PF13374 TPR_10 Tetratricopeptide repeat 6.0E-12 936 977
PF13374 TPR_10 Tetratricopeptide repeat 1.5E-11 978 1019
PF13374 TPR_10 Tetratricopeptide repeat 2.1E-12 1020 1061
PF13374 TPR_10 Tetratricopeptide repeat 1.4E-06 1062 1100
PF13424 TPR_12 Tetratricopeptide repeat 6.3E-11 770 833
PF13424 TPR_12 Tetratricopeptide repeat 1.6E-07 866 917
PF13424 TPR_12 Tetratricopeptide repeat 3.2E-07 950 1001
PF13424 TPR_12 Tetratricopeptide repeat 3.2E-08 1034 1085
PF01734 Patatin Patatin-like phospholipase 1.8E-22 25 227
PF00931 NB-ARC NB-ARC domain 8.2E-06 404 617

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 803 1095 2.0E-32
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 804 1097 5.0E-31
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 771 1053 2.0E-29
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 804 1095 2.0E-29
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 808 1097 6.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 803 1095 2.0E-32
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 804 1097 5.0E-31
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 771 1053 2.0E-29
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 804 1095 2.0E-29
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 808 1097 6.0E-29
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 771 1013 1.0E-28
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 771 1055 1.0E-28
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 804 1099 2.0E-28
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 808 1099 2.0E-28
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 804 1079 3.0E-28
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 888 1085 4.0E-28
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 771 1068 5.0E-28
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 771 1068 6.0E-28
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 771 1052 9.0E-28
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 804 1097 1.0E-27
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 808 1095 2.0E-27
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 808 1095 4.0E-27
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 771 1068 5.0E-27
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 770 1011 8.0E-27
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 770 1013 1.0E-26
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 796 1091 1.0E-26
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 804 1001 1.0E-26
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 888 1095 2.0E-26
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 796 1091 2.0E-26
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 771 1027 3.0E-26
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 771 1055 5.0E-26
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 771 1055 1.0E-25
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 796 1091 1.0E-25
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 804 1068 3.0E-25
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 752 1026 3.0E-25
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 804 1095 4.0E-25
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 804 1095 9.0E-25
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 771 1027 1.0E-24
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 771 1027 2.0E-24
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 796 1091 2.0E-24
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 808 1001 2.0E-24
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 803 1091 2.0E-24
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 808 1001 2.0E-24
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 761 1060 3.0E-24
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 808 1008 3.0E-24
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 808 1008 3.0E-24
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 761 1078 9.0E-24
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 770 1010 1.0E-23
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 770 1013 2.0E-23
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 808 1001 2.0E-23
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 892 1092 6.0E-23
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 850 1043 7.0E-23
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 892 1085 7.0E-23
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 850 1043 7.0E-23
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 850 1050 7.0E-23
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 850 1050 7.0E-23
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 892 1085 8.0E-23
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 892 1092 9.0E-23
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 892 1092 9.0E-23
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 770 1038 2.0E-22
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 12 334 2.0E-22
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 771 959 3.0E-22
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 771 959 5.0E-22
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 771 966 5.0E-22
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 771 966 6.0E-22
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 850 1050 6.0E-22
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 17 334 9.0E-22
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 12 334 9.0E-22
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 731 1007 2.0E-21
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 771 966 4.0E-21
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 930 1083 6.0E-21
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 772 1007 1.0E-20
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 771 965 1.0E-18
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 749 917 2.0E-18
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 749 917 3.0E-18
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 749 917 3.0E-18
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 749 924 3.0E-18
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 749 924 3.0E-18
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 22 319 4.0E-18
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 748 981 3.0E-17
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 897 1100 4.0E-14
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 897 1100 6.0E-13
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 898 1100 1.0E-11
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 898 1100 2.0E-11
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 972 1100 4.0E-11
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 976 1100 4.0E-11
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 972 1100 5.0E-11
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 972 1100 5.0E-11
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 972 1097 6.0E-11
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 897 1100 1.0E-10
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 976 1100 2.0E-10
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 976 1100 2.0E-10
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 972 1100 3.0E-10
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 976 1100 4.0E-10
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 976 1100 4.0E-10
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 976 1100 6.0E-10
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 976 1100 6.0E-10
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 976 1100 6.0E-10
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 972 1097 7.0E-10
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 972 1100 1.0E-09
sp|O23180|PLP5_ARATH Patatin-like protein 5 OS=Arabidopsis thaliana GN=PLP5 PE=1 SV=2 19 322 3.0E-09
sp|O48723|PLP2_ARATH Patatin-like protein 2 OS=Arabidopsis thaliana GN=PLP2 PE=1 SV=1 22 305 3.0E-08
sp|B8AQW7|PLP1_ORYSI Patatin-like protein 1 OS=Oryza sativa subsp. indica GN=PLP1 PE=3 SV=1 12 230 1.0E-07
sp|Q6ZJD3|PLP2_ORYSJ Patatin-like protein 2 OS=Oryza sativa subsp. japonica GN=PLP2 PE=3 SV=1 22 306 2.0E-07
sp|A2YW91|PLP2_ORYSI Patatin-like protein 2 OS=Oryza sativa subsp. indica GN=PLP2 PE=3 SV=1 22 306 2.0E-07
sp|Q93ZQ3|PLP9_ARATH Probable inactive patatin-like protein 9 OS=Arabidopsis thaliana GN=PLP9 PE=2 SV=1 23 228 1.0E-06
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 884 1072 4.0E-06
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 684 990 5.0E-06
sp|Q4PA50|CLU_USTMA Clustered mitochondria protein homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CLU1 PE=3 SV=1 799 966 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0043531 ADP binding Yes
GO:0032559 adenyl ribonucleotide binding No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0036094 small molecule binding No
GO:0044238 primary metabolic process No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0032555 purine ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup243
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016000
Agaricus bisporus var bisporus H39 AgabiH39|474700
Agaricus bisporus var bisporus H39 AgabiH39|447800
Agaricus bisporus var bisporus H39 AgabiH39|447100
Agaricus bisporus var bisporus H39 AgabiH39|373300
Agaricus bisporus var bisporus H39 AgabiH39|481100
Agaricus bisporus var bisporus H39 AgabiH39|281600
Agaricus bisporus var bisporus H39 AgabiH39|278300
Agaricus bisporus var bisporus H39 AgabiH39|053070
Agaricus bisporus var bisporus H39 AgabiH39|371700 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|109720
Agaricus bisporus var bisporus H97 AgabiH97|016000
Agaricus bisporus var bisporus H97 AgabiH97|016120
Agaricus bisporus var bisporus H97 AgabiH97|020470
Agaricus bisporus var bisporus H97 AgabiH97|052840
Agaricus bisporus var bisporus H97 AgabiH97|052910
Agaricus bisporus var bisporus H97 AgabiH97|053070
Agaricus bisporus var bisporus H97 AgabiH97|054350
Agaricus bisporus var bisporus H97 AgabiH97|089750
Agaricus bisporus var bisporus H97 AgabiH97|109860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|371700
MHKMSSSTRNSGSRSTLDGPPLRLLALDGGGIRGLSELLILKEVMHKLMFEENEKRKKGGEKPLSALPKPCDYFD
LIGGTSTGGIIALMLGRLRMDVDTAIKNYDDLAKQVFSAMKLWGDGKFKATTLEAAMKSVVKTVTGDSESPLLEG
DQAGVCRTFVCAKNAHNLYIPVLFRTYPSSETHSNCKIWEAARATSAAPTFFKRVIIGRDQPFIDGGLGRNNPSQ
VVLEEANVLFGARQIGCLVSIGTGQAEVNEIKKPGLWQQILPTDVIDALKRITTDCESTHEDVLRRFSKLPNTYF
RLNVDQGMQGIELSEWEKLSNVEAHTMQYMRKEEVVGRLALLVGAIRDPRGQLSLEQLITPTPPKELVPQVRERK
RCPLPVSPFMGREVTLDKMRRYFEVGGDSRRVFVLHGLGGSGKTQIAFKFVQESTCFSDVFYIDATNEQTLRTDL
EAIAPGNTEQSSDSSLHWLASQREGNWLLFFDNADDVNLKLNEFIPQCRSGNILVTTRNHELRLLSAKDGDAKVG
AMEHEDATNLLLDRARAEESDENKVLAEAIVQELHYFALAICQAGAYIHCRLSLGEYREFYRRHHDKLLQNKEFQ
GEDPYERAVYATWSLSYNKLDAPARSLLQIFSLLNHEGISEEMFEKAASSEEQLEDPELQNKVNELLNKLGKRGP
GWPWDFKQVIEHLCSYSLIEYDARNHTYSIHPLVQQWSRSTMEGNRQLMRKCVLGIIGLSISWTFDDQDYKYRRK
LLQHISSSRASVDPEQMTPSVLNGMALVYFEQGRWKEAEALEVVVMEKSKRLLGDDHPHTLTSMANLASTYWNQG
QWKEAEALEVVVMEKRKRLLGDDHPDTLTIMANLASTYSNQGQWKEAEALQVVVMEKRKRLLGDDHPHTLTSMAN
LASTYRNQGQWKDAEALEVVVMEKRKRLLGDDHPDTLTSMANLASTYWNQGQWKDAEALQVVVMEKRKRLLGDDH
PHTLTSMANLASTYRNQGQWKDAEALEVVVMEKRKRLLGDDHPHTLTIMANLASTYSNQGQWKEAEALQVVVMEK
RKRLLGDDHPDTLKSMANLASTYWNQGQWKEAEALQVVVMEKSKQLLSDD*
Coding >AgabiH39|371700
ATGCATAAGATGTCATCTAGCACAAGGAACTCGGGATCCCGATCAACTTTAGACGGACCACCTTTGAGGCTTCTT
GCGCTAGATGGCGGTGGGATTCGTGGACTTTCAGAACTACTCATCCTCAAAGAAGTTATGCACAAGCTGATGTTT
GAGGAGAACGAGAAACGGAAGAAGGGCGGCGAAAAACCTCTTAGCGCACTCCCGAAGCCGTGCGATTACTTCGAT
CTGATTGGTGGTACTAGTACTGGAGGGATAATTGCTTTAATGCTTGGGCGTCTTCGGATGGATGTAGACACGGCA
ATAAAAAACTATGATGATCTGGCAAAACAAGTCTTCTCTGCTATGAAGCTATGGGGAGACGGAAAATTCAAAGCG
ACAACACTCGAAGCAGCCATGAAATCTGTCGTGAAGACCGTAACTGGTGATTCAGAGTCACCCTTATTAGAGGGT
GACCAAGCTGGAGTCTGCCGGACTTTCGTCTGTGCAAAGAACGCCCACAACCTGTACATTCCAGTGCTTTTCAGG
ACATACCCGTCTAGTGAAACGCATTCAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACGTCTGCAGCACCTACA
TTTTTTAAGCGCGTTATAATTGGGCGGGACCAACCCTTTATCGATGGCGGACTAGGCCGCAATAATCCGAGTCAG
GTGGTACTGGAGGAAGCCAATGTTCTATTTGGTGCTCGTCAAATCGGGTGCTTGGTGAGCATTGGCACTGGACAG
GCCGAAGTAAACGAGATCAAGAAACCTGGGCTATGGCAACAAATTTTACCGACCGACGTCATTGATGCGTTAAAA
AGAATAACCACCGACTGCGAATCAACACACGAAGATGTGTTGCGTCGTTTCTCCAAGTTGCCGAACACCTACTTT
CGACTAAATGTCGACCAGGGAATGCAGGGAATAGAACTTTCCGAATGGGAGAAACTGAGCAATGTGGAGGCTCAT
ACAATGCAATATATGAGGAAGGAGGAGGTCGTTGGGAGGCTTGCCTTGTTGGTTGGTGCGATCAGAGACCCGAGA
GGGCAGCTTTCACTCGAGCAACTTATTACCCCTACGCCTCCAAAGGAATTGGTCCCACAAGTTAGGGAACGAAAG
CGTTGTCCGCTTCCTGTGTCACCATTCATGGGACGAGAGGTAACCCTTGATAAGATGCGCAGATATTTTGAGGTG
GGGGGTGATTCTCGACGCGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCATTCAAATTT
GTGCAAGAATCAACCTGCTTCTCCGACGTCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACAGACCTT
GAGGCCATCGCTCCAGGAAATACAGAGCAATCATCAGATTCGAGTCTCCATTGGCTTGCAAGCCAGCGCGAGGGG
AACTGGCTTCTCTTCTTCGACAACGCGGACGATGTGAACTTGAAACTGAATGAATTCATTCCTCAGTGTCGATCT
GGAAACATCCTGGTTACAACACGTAACCATGAGCTTCGCCTTCTCTCTGCGAAAGACGGGGACGCAAAAGTTGGT
GCGATGGAGCACGAAGACGCAACAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGCGATGAAAATAAAGTG
CTGGCAGAGGCAATTGTACAGGAACTCCATTACTTTGCTTTGGCTATTTGCCAAGCCGGCGCTTACATTCATTGC
CGCTTGTCATTAGGCGAATATCGAGAATTCTATCGACGTCACCACGACAAACTGTTACAGAATAAAGAGTTCCAA
GGAGAAGATCCATACGAACGAGCGGTGTATGCGACGTGGAGTTTGAGTTACAACAAACTTGACGCGCCAGCGAGA
TCTTTGCTCCAAATTTTCTCGTTGCTAAATCACGAAGGAATCTCGGAGGAAATGTTCGAAAAGGCGGCATCGTCT
GAAGAGCAACTGGAGGATCCCGAACTACAAAACAAAGTGAATGAGTTGTTGAACAAGCTGGGAAAACGAGGTCCA
GGCTGGCCTTGGGACTTTAAGCAGGTCATCGAACATCTTTGTTCATATTCGCTCATTGAATATGATGCTCGAAAT
CACACCTACAGCATTCATCCGCTAGTACAACAATGGAGTCGTAGCACCATGGAAGGAAACAGGCAGCTCATGCGG
AAATGTGTACTCGGCATCATTGGCCTATCAATTTCTTGGACATTCGACGACCAGGACTACAAGTATCGACGCAAA
CTTTTACAGCATATCTCCAGCTCCAGAGCCTCGGTTGATCCAGAACAGATGACGCCTTCGGTTTTGAATGGTATG
GCACTTGTGTACTTTGAACAGGGGCGGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGCAAG
CGGCTGCTCGGTGATGATCATCCTCACACGCTCACAAGCATGGCCAATCTTGCATCTACATACTGGAACCAGGGG
CAGTGGAAAGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCATCCT
GACACGCTCACAATCATGGCCAATCTTGCGTCTACATACTCGAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTT
CAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCATCCTCACACGCTCACAAGCATGGCCAAT
CTTGCATCTACATACAGGAACCAGGGGCAGTGGAAGGACGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGG
AAGCGGCTGCTCGGTGATGATCATCCTGACACGCTCACAAGCATGGCCAATCTTGCGTCTACATACTGGAACCAG
GGGCAGTGGAAGGACGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCAT
CCTCACACGCTCACAAGCATGGCCAATCTTGCGTCTACATACAGGAACCAGGGGCAGTGGAAGGACGCAGAGGCG
CTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCATCCTCACACGCTCACAATCATGGCC
AATCTTGCGTCTACATACTCGAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAG
AGGAAGCGGCTGCTCGGTGATGATCATCCTGACACGCTCAAAAGCATGGCCAATCTTGCATCTACATACTGGAAC
CAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGAGCAAGCAGCTGCTCAGTGATGAT
TGA
Transcript >AgabiH39|371700
ATGCATAAGATGTCATCTAGCACAAGGAACTCGGGATCCCGATCAACTTTAGACGGACCACCTTTGAGGCTTCTT
GCGCTAGATGGCGGTGGGATTCGTGGACTTTCAGAACTACTCATCCTCAAAGAAGTTATGCACAAGCTGATGTTT
GAGGAGAACGAGAAACGGAAGAAGGGCGGCGAAAAACCTCTTAGCGCACTCCCGAAGCCGTGCGATTACTTCGAT
CTGATTGGTGGTACTAGTACTGGAGGGATAATTGCTTTAATGCTTGGGCGTCTTCGGATGGATGTAGACACGGCA
ATAAAAAACTATGATGATCTGGCAAAACAAGTCTTCTCTGCTATGAAGCTATGGGGAGACGGAAAATTCAAAGCG
ACAACACTCGAAGCAGCCATGAAATCTGTCGTGAAGACCGTAACTGGTGATTCAGAGTCACCCTTATTAGAGGGT
GACCAAGCTGGAGTCTGCCGGACTTTCGTCTGTGCAAAGAACGCCCACAACCTGTACATTCCAGTGCTTTTCAGG
ACATACCCGTCTAGTGAAACGCATTCAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACGTCTGCAGCACCTACA
TTTTTTAAGCGCGTTATAATTGGGCGGGACCAACCCTTTATCGATGGCGGACTAGGCCGCAATAATCCGAGTCAG
GTGGTACTGGAGGAAGCCAATGTTCTATTTGGTGCTCGTCAAATCGGGTGCTTGGTGAGCATTGGCACTGGACAG
GCCGAAGTAAACGAGATCAAGAAACCTGGGCTATGGCAACAAATTTTACCGACCGACGTCATTGATGCGTTAAAA
AGAATAACCACCGACTGCGAATCAACACACGAAGATGTGTTGCGTCGTTTCTCCAAGTTGCCGAACACCTACTTT
CGACTAAATGTCGACCAGGGAATGCAGGGAATAGAACTTTCCGAATGGGAGAAACTGAGCAATGTGGAGGCTCAT
ACAATGCAATATATGAGGAAGGAGGAGGTCGTTGGGAGGCTTGCCTTGTTGGTTGGTGCGATCAGAGACCCGAGA
GGGCAGCTTTCACTCGAGCAACTTATTACCCCTACGCCTCCAAAGGAATTGGTCCCACAAGTTAGGGAACGAAAG
CGTTGTCCGCTTCCTGTGTCACCATTCATGGGACGAGAGGTAACCCTTGATAAGATGCGCAGATATTTTGAGGTG
GGGGGTGATTCTCGACGCGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCATTCAAATTT
GTGCAAGAATCAACCTGCTTCTCCGACGTCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACAGACCTT
GAGGCCATCGCTCCAGGAAATACAGAGCAATCATCAGATTCGAGTCTCCATTGGCTTGCAAGCCAGCGCGAGGGG
AACTGGCTTCTCTTCTTCGACAACGCGGACGATGTGAACTTGAAACTGAATGAATTCATTCCTCAGTGTCGATCT
GGAAACATCCTGGTTACAACACGTAACCATGAGCTTCGCCTTCTCTCTGCGAAAGACGGGGACGCAAAAGTTGGT
GCGATGGAGCACGAAGACGCAACAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGCGATGAAAATAAAGTG
CTGGCAGAGGCAATTGTACAGGAACTCCATTACTTTGCTTTGGCTATTTGCCAAGCCGGCGCTTACATTCATTGC
CGCTTGTCATTAGGCGAATATCGAGAATTCTATCGACGTCACCACGACAAACTGTTACAGAATAAAGAGTTCCAA
GGAGAAGATCCATACGAACGAGCGGTGTATGCGACGTGGAGTTTGAGTTACAACAAACTTGACGCGCCAGCGAGA
TCTTTGCTCCAAATTTTCTCGTTGCTAAATCACGAAGGAATCTCGGAGGAAATGTTCGAAAAGGCGGCATCGTCT
GAAGAGCAACTGGAGGATCCCGAACTACAAAACAAAGTGAATGAGTTGTTGAACAAGCTGGGAAAACGAGGTCCA
GGCTGGCCTTGGGACTTTAAGCAGGTCATCGAACATCTTTGTTCATATTCGCTCATTGAATATGATGCTCGAAAT
CACACCTACAGCATTCATCCGCTAGTACAACAATGGAGTCGTAGCACCATGGAAGGAAACAGGCAGCTCATGCGG
AAATGTGTACTCGGCATCATTGGCCTATCAATTTCTTGGACATTCGACGACCAGGACTACAAGTATCGACGCAAA
CTTTTACAGCATATCTCCAGCTCCAGAGCCTCGGTTGATCCAGAACAGATGACGCCTTCGGTTTTGAATGGTATG
GCACTTGTGTACTTTGAACAGGGGCGGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGCAAG
CGGCTGCTCGGTGATGATCATCCTCACACGCTCACAAGCATGGCCAATCTTGCATCTACATACTGGAACCAGGGG
CAGTGGAAAGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCATCCT
GACACGCTCACAATCATGGCCAATCTTGCGTCTACATACTCGAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTT
CAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCATCCTCACACGCTCACAAGCATGGCCAAT
CTTGCATCTACATACAGGAACCAGGGGCAGTGGAAGGACGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGG
AAGCGGCTGCTCGGTGATGATCATCCTGACACGCTCACAAGCATGGCCAATCTTGCGTCTACATACTGGAACCAG
GGGCAGTGGAAGGACGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCAT
CCTCACACGCTCACAAGCATGGCCAATCTTGCGTCTACATACAGGAACCAGGGGCAGTGGAAGGACGCAGAGGCG
CTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCATCCTCACACGCTCACAATCATGGCC
AATCTTGCGTCTACATACTCGAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAG
AGGAAGCGGCTGCTCGGTGATGATCATCCTGACACGCTCAAAAGCATGGCCAATCTTGCATCTACATACTGGAAC
CAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGAGCAAGCAGCTGCTCAGTGATGAT
TGA
Gene >AgabiH39|371700
ATGCATAAGATGTCATCTAGCACAAGGAACTCGGGATCCCGATCAACGTTCGGGGCCCCCTTTCGCTTCTCAATA
ACCAGTTATCGCAGCAAACAGTACTAGGCTTTTCCGTGAGAAAGTTTAGGTGCGTCCATACAGCATGTCATATCT
CACAGCCTCTCCTTGGTCTTAACAATGACTTCTTCTGCAGACGGACCACCTTTGAGGCTTCTTGCGCTAGGTATG
TGCGTCTGTTTGCACTCTCTCACTGATAGAGTCGCTAACTAGTGACCTCTGAACAGATGGCGGTGGGATTCGTGG
ACTTTCAGAACTACTCATCCTCAAAGAAGTTATGCACAAGCTGATGTTTGAGGAGAACGAGAAACGGAAGAAGGG
CGGCGAAAAACCTCTTAGCGCACTCCCGAAGCCGTGCGATTACTTCGATCTGATTGGTGGTACTAGTACTGGAGG
GTGCGTTGAGTTATGCATCTACAATCATCTCATGTTACTCACATGTATATTATAGGATAATTGCTTTAATGCTTG
GGCGTCTTCGGATGGATGTAGACACGGCAATAAAAAACTATGATGATCTGGCAAAACAAGTCTTCTCTGCTATGA
AGCTATGGGGAGACGGAAAATTCAAAGCGACAACACTCGAAGCAGCCATGAAATCTGTCGTGAAGACCGTAACTG
GTGATTCAGAGTCACCCTTATTAGAGGGTGACCAAGCTGGAGTCTGCCGGACGTGAGTATATTACTTACTCTTCC
ATGCGTTTGGACTTTGAATTCGAAGATTTATTAGTTTCGTCTGTGCAAAGAACGCCCACAACCTGTACATTCCAG
TGCTTTTCAGGACATACCCGTCTAGTGAAACGCATTCAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACGTCTG
CAGCACCTACATTTTTTAAGCGCGTTATAATTGGGCGGGACCAACCCTTTATCGATGGCGGACTAGGCCGCAATA
ATCCGAGTCAGGTGGTACTGGAGGAAGCCAATGTTCTATTTGGTGCTCGTCAAATCGGGTGCTTGGTGAGCATTG
GCACTGGACAGGCCGAAGTAAACGAGATCAAGAAACCTGGGCTATGGCAACAAATTTTACCGACCGACGTCATTG
ATGCGTTAAAAAGAATAACCACCGACTGCGAATCAACACACGAAGATGTGTTGCGTCGTTTCTCCAAGTTGCCGA
ACACCTACTTTCGACTAAATGTCGACCAGGGAATGCAGGGAATAGAACTTTCCGAATGGGAGAAACTGAGCAATG
TGGAGGCTCATACAATGCAATATATGAGGAAGGAGGAGGTCGTTGGGAGGCTTGCCTTGTTGGTTGGTGCGATCA
GAGACCCGAGAGGGCAGCTTTCACTCGAGCAACTTAGTATGGAAAAATTGCTCTTCTAGATCTTCATAATAATCT
AATCTCGTTACCCTAGTTACCCCTACGCCTCCAAAGGAATTGGTCCCACAAGTTAGGGAACGAAAGCGTTGTCCG
CTTCCTGTGTCACCATTCATGGGACGAGAGGTAACCCTTGATAAGATGCGCAGATATTTTGAGGTGGGGGGTGAT
TCTCGACGCGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCATTCAAATTTGTGCAAGAA
TCAACCTGGTATGATCCTAGTCTCTACAAATCCGCGACTGGCGACAATTTATTTGTTGTATTTCCAGCTTCTCCG
ACGTCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACAGACCTTGAGGCCATCGCTCCAGGAAATACAG
AGCAATCATCAGATTCGAGTCTCCATTGGCTTGCAAGCCAGCGCGAGGGGAACTGGCTTCTCTTCTTCGACAACG
CGGACGATGTGAACTTGAAACTGAATGAATTCATTCCTCAGTGTCGATCTGGAAACATCCTGGTTACAACACGTA
ACCATGAGCTTCGCCTTCTCTCTGCGAAAGACGGGGACGCAAAAGTTGGTGCGATGGAGCACGAAGACGCAACAA
ACCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGCGATGAAAATAAAGTGCTGGCAGAGGCAATTGTACAGGTTC
GTCCTCTCATTTTCGTTTCTTTAGAAAACACTTTGAGTCTGAAGCACGAGACAGGAACTCCATTACTTTGCTTTG
GCTATTTGCCAAGCCGGCGCTTACATTCATTGCCGCTTGTCATTAGGCGAATATCGAGAATTCTATCGACGTCAC
CACGACAAACTGTTACAGAATAAAGAGTTCCAAGGAGAAGATCCATACGAACGAGCGGTGTATGCGACGTGGAGT
TTGAGTTACAACAAACTTGACGCGCCAGCGAGATCTTTGCTCCAAATTTTCTCGTTGCTAAATCACGAAGGAATC
TCGGAGGAAATGTTCGAAAAGGCGGCATCGTCTGAAGAGCAACTGGAGGATCCCGAACTACAAAACAAAGTGAAT
GAGTTGTTGAACAAGCTGGGAAAACGAGGTCCAGGCTGGCCTTGGGACTTTAAGCAGGTCATCGAACATCTTTGT
TCATATTCGCTCATTGAATATGATGCTCGAAATCACACCTACAGCATTCATCCGCTAGTACAACAATGGAGTCGT
AGCACCATGGAAGGAAACAGGCAGCTCATGCGGAAATGTGTACTCGGCATCATTGGCCTATCAATTTCTTGGACA
TTCGACGACCAGGACTACAAGTATCGACGCAAACTTTTACAGCATATCTCCAGCTCCAGAGCCTCGGTTGATCCA
GAACAGATGACGCCTTCGGTTTTGAATGGTATGGCACTTGTGTACTTTGAACAGGGGCGGTGGAAGGAAGCAGAG
GCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAACGGCTGCTCGGTGATGATCATCCTGACACGCTCACAAGCATG
GCCAATCTTGCGTCTACATACTGGAACCAGGGGCAGTGGAAAGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAG
AAGAGCAAGCGGCTGCTCGGTGATGATCATCCTCACACGCTCACAAGCATGGCCAATCTTGCATCTACATACTGG
AACCAGGGGCAGTGGAAAGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGAT
GATCATCCTGACACGCTCACAATCATGGCCAATCTTGCGTCTACATACTCGAACCAGGGGCAGTGGAAGGAAGCA
GAGGCGCTTCAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCATCCTCACACGCTCACAAGC
ATGGCCAATCTTGCATCTACATACAGGAACCAGGGGCAGTGGAAGGACGCAGAGGCGCTTGAGGTGGTGGTGATG
GAGAAGAGGAAGCGGCTGCTCGGTGATGATCATCCTGACACGCTCACAAGCATGGCCAATCTTGCGTCTACATAC
TGGAACCAGGGGCAGTGGAAGGACGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGT
GATGATCATCCTCACACGCTCACAAGCATGGCCAATCTTGCGTCTACATACAGGAACCAGGGGCAGTGGAAGGAC
GCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCATCCTCACACGCTCACA
ATCATGGCCAATCTTGCGTCTACATACTCGAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTG
ATGGAGAAGAGGAAGCGGCTGCTCGGTGATGATCATCCTGACACGCTCAAAAGCATGGCCAATCTTGCATCTACA
TACTGGAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGAGCAAGCAGCTGCTC
AGTGATGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail