Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|370300
Gene name
Locationscaffold_06a:393660..395578
Strand+
Gene length (bp)1918
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00494 SQS_PSY Squalene/phytoene synthase 1.1E-35 59 327

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92459|FDFT_USTMA Squalene synthase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG9 PE=3 SV=2 1 416 2.0E-148
sp|Q7S4Z6|FDFT_NEUCR Probable squalene synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-6 PE=3 SV=1 1 395 3.0E-124
sp|P36596|FDFT_SCHPO Squalene synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg9 PE=1 SV=1 16 394 4.0E-123
sp|O74165|FDFT_CYBJA Squalene synthase OS=Cyberlindnera jadinii GN=ERG9 PE=3 SV=1 1 441 6.0E-114
sp|Q9Y753|FDFT_YARLI Squalene synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SQS1 PE=3 SV=1 10 387 8.0E-114
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92459|FDFT_USTMA Squalene synthase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG9 PE=3 SV=2 1 416 2.0E-148
sp|Q7S4Z6|FDFT_NEUCR Probable squalene synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-6 PE=3 SV=1 1 395 3.0E-124
sp|P36596|FDFT_SCHPO Squalene synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg9 PE=1 SV=1 16 394 4.0E-123
sp|O74165|FDFT_CYBJA Squalene synthase OS=Cyberlindnera jadinii GN=ERG9 PE=3 SV=1 1 441 6.0E-114
sp|Q9Y753|FDFT_YARLI Squalene synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SQS1 PE=3 SV=1 10 387 8.0E-114
sp|P78589|FDFT_CANAX Squalene synthase OS=Candida albicans GN=ERG9 PE=3 SV=1 10 435 8.0E-108
sp|P29704|FDFT_YEAST Squalene synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG9 PE=1 SV=2 1 417 1.0E-101
sp|Q752X9|FDFT_ASHGO Squalene synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG9 PE=3 SV=1 10 393 8.0E-95
sp|P53798|FDFT_MOUSE Squalene synthase OS=Mus musculus GN=Fdft1 PE=1 SV=2 11 395 2.0E-94
sp|Q02769|FDFT_RAT Squalene synthase OS=Rattus norvegicus GN=Fdft1 PE=2 SV=1 11 374 1.0E-93
sp|Q32KR6|FDFT_BOVIN Squalene synthase OS=Bos taurus GN=FDFT1 PE=2 SV=1 11 373 2.0E-92
sp|Q5R6U3|FDFT_PONAB Squalene synthase OS=Pongo abelii GN=FDFT1 PE=2 SV=1 11 374 1.0E-91
sp|P37268|FDFT_HUMAN Squalene synthase OS=Homo sapiens GN=FDFT1 PE=1 SV=1 11 374 1.0E-91
sp|Q9HGZ6|FDFT_CANGA Squalene synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG9 PE=3 SV=2 1 399 1.0E-90
sp|Q54DR1|FDFT_DICDI Squalene synthase OS=Dictyostelium discoideum GN=fdfT PE=3 SV=1 11 389 1.0E-83
sp|Q9SDW9|BSS_BOTBR Squalene synthase OS=Botryococcus braunii GN=BSS PE=1 SV=1 1 390 4.0E-81
sp|G0Y287|BOSS_BOTBR Botryococcus squalene synthase OS=Botryococcus braunii GN=SSL-2 PE=1 SV=1 7 367 5.0E-79
sp|P53799|FDFT_ARATH Squalene synthase OS=Arabidopsis thaliana GN=SQS1 PE=1 SV=1 52 405 6.0E-74
sp|P53800|FDFT_NICBE Squalene synthase OS=Nicotiana benthamiana PE=2 SV=1 52 374 2.0E-72
sp|G0Y288|BOCS_BOTBR Botryococcene synthase OS=Botryococcus braunii GN=SSL-3 PE=2 SV=1 10 375 6.0E-54
sp|G0Y286|PSDS_BOTBR Presqualene diphosphate synthase OS=Botryococcus braunii GN=SSL-1 PE=1 SV=1 10 349 9.0E-51
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 303 325 22
2 474 496 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup2884
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|370300 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|089560
Rhodonia placenta FPRL280 RhoplFPRL280|20_12

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|370300
MGATKWLALLLFHPLEFRTLLQFYLYHEQKRDIKALKEHPTSGWDRQSMRRCWDFLDMTSRSFSAVIKELDGDLA
RTICLFYLVLRGLDTIEDDMTIPDKVKQPILRKFHELTVEHGWKFDGCGPNEKDRQLLVEYDTIVEEVNRLDPSF
KEVIIDICHKMENGMADFAHQAATTGKIYIATVAEYDLYCHYVAGLVGEGLSRIFTASGKEAEWLGQQLELSNSM
GLLLQKTNIIRDYREDTDDQRYFWPKEIWGKYGFNEMKEMYAPGASEKAQWVQSGMILDALRHATDALEYLRFLK
NQTIFNFCAIPASMAIATLELCFMNSDMFERNIKIRKATAAQLIMRSTNPRDVGQIFCEYARKIHAKAVPTDPNF
MQISVACGKIEQWCEQNYPSFIQPPNAPGNPPTLDGYDARSRIAEADNKFTSELATRKRMIEIANGDRQIAMQRI
ERFTGGGSNTQASNNGAVSTTTMMFYIAAGIVLIVAVGFGVTFAVIKAAGISLKGSGST*
Coding >AgabiH39|370300
ATGGGTGCTACGAAATGGCTCGCTCTTCTCCTCTTCCACCCTCTCGAATTCAGGACTCTGCTCCAGTTCTACCTC
TACCATGAGCAGAAGCGTGATATCAAGGCCTTGAAGGAGCACCCGACGTCGGGCTGGGACCGGCAGTCGATGCGG
AGATGTTGGGACTTCCTGGACATGACAAGTAGGAGTTTTTCGGCTGTTATTAAGGAACTAGACGGCGACCTGGCT
CGAACAATATGTCTGTTTTACCTCGTTCTTCGAGGTCTGGACACGATCGAAGATGATATGACCATTCCAGACAAA
GTCAAGCAACCCATTTTACGAAAGTTTCACGAATTAACCGTCGAACATGGATGGAAATTCGACGGTTGCGGTCCT
AATGAGAAGGACCGCCAACTCCTTGTCGAATATGACACAATTGTTGAAGAAGTCAACCGCCTTGACCCTTCCTTC
AAAGAGGTCATTATTGACATTTGCCATAAAATGGAAAATGGCATGGCCGACTTTGCCCATCAAGCCGCAACAACA
GGGAAGATTTACATTGCGACCGTCGCTGAATACGACCTATACTGTCACTACGTCGCAGGCCTCGTCGGTGAGGGG
TTATCCCGAATTTTCACCGCATCAGGGAAAGAAGCCGAGTGGCTTGGTCAGCAGCTCGAGTTATCGAACTCCATG
GGACTTCTTCTACAAAAGACCAACATCATCCGTGACTACCGAGAGGACACTGACGATCAACGATATTTCTGGCCC
AAAGAAATTTGGGGCAAGTATGGTTTCAACGAGATGAAGGAAATGTACGCACCAGGGGCATCAGAAAAAGCCCAA
TGGGTGCAGAGCGGAATGATCTTGGATGCTCTCAGGCACGCGACTGATGCTTTGGAATATCTCCGATTCTTAAAG
AACCAGACCATTTTCAACTTTTGTGCCATTCCTGCCTCCATGGCTATCGCCACCCTAGAGCTGTGCTTTATGAAC
TCTGATATGTTCGAGCGGAATATCAAGATTCGCAAGGCTACTGCCGCTCAGCTTATTATGCGGTCTACAAATCCT
CGCGATGTTGGTCAGATCTTCTGCGAATACGCTCGTAAAATTCATGCAAAAGCCGTCCCGACCGATCCCAACTTC
ATGCAGATTTCAGTCGCCTGTGGCAAGATTGAACAGTGGTGTGAACAAAATTACCCTTCATTCATCCAACCACCT
AACGCACCAGGTAACCCTCCCACGCTGGACGGATATGATGCTCGTTCACGCATCGCCGAGGCCGACAACAAATTT
ACATCAGAACTCGCTACCCGTAAACGTATGATCGAAATAGCCAACGGAGATCGTCAAATCGCAATGCAACGAATT
GAGAGATTCACAGGTGGTGGCAGTAATACCCAAGCGTCGAACAATGGTGCAGTGTCGACAACGACTATGATGTTC
TATATCGCTGCTGGGATTGTATTGATTGTCGCTGTCGGTTTCGGTGTAACGTTCGCTGTTATCAAGGCTGCTGGT
ATTTCTTTGAAAGGTTCGGGGTCAACATAA
Transcript >AgabiH39|370300
ATGGGTGCTACGAAATGGCTCGCTCTTCTCCTCTTCCACCCTCTCGAATTCAGGACTCTGCTCCAGTTCTACCTC
TACCATGAGCAGAAGCGTGATATCAAGGCCTTGAAGGAGCACCCGACGTCGGGCTGGGACCGGCAGTCGATGCGG
AGATGTTGGGACTTCCTGGACATGACAAGTAGGAGTTTTTCGGCTGTTATTAAGGAACTAGACGGCGACCTGGCT
CGAACAATATGTCTGTTTTACCTCGTTCTTCGAGGTCTGGACACGATCGAAGATGATATGACCATTCCAGACAAA
GTCAAGCAACCCATTTTACGAAAGTTTCACGAATTAACCGTCGAACATGGATGGAAATTCGACGGTTGCGGTCCT
AATGAGAAGGACCGCCAACTCCTTGTCGAATATGACACAATTGTTGAAGAAGTCAACCGCCTTGACCCTTCCTTC
AAAGAGGTCATTATTGACATTTGCCATAAAATGGAAAATGGCATGGCCGACTTTGCCCATCAAGCCGCAACAACA
GGGAAGATTTACATTGCGACCGTCGCTGAATACGACCTATACTGTCACTACGTCGCAGGCCTCGTCGGTGAGGGG
TTATCCCGAATTTTCACCGCATCAGGGAAAGAAGCCGAGTGGCTTGGTCAGCAGCTCGAGTTATCGAACTCCATG
GGACTTCTTCTACAAAAGACCAACATCATCCGTGACTACCGAGAGGACACTGACGATCAACGATATTTCTGGCCC
AAAGAAATTTGGGGCAAGTATGGTTTCAACGAGATGAAGGAAATGTACGCACCAGGGGCATCAGAAAAAGCCCAA
TGGGTGCAGAGCGGAATGATCTTGGATGCTCTCAGGCACGCGACTGATGCTTTGGAATATCTCCGATTCTTAAAG
AACCAGACCATTTTCAACTTTTGTGCCATTCCTGCCTCCATGGCTATCGCCACCCTAGAGCTGTGCTTTATGAAC
TCTGATATGTTCGAGCGGAATATCAAGATTCGCAAGGCTACTGCCGCTCAGCTTATTATGCGGTCTACAAATCCT
CGCGATGTTGGTCAGATCTTCTGCGAATACGCTCGTAAAATTCATGCAAAAGCCGTCCCGACCGATCCCAACTTC
ATGCAGATTTCAGTCGCCTGTGGCAAGATTGAACAGTGGTGTGAACAAAATTACCCTTCATTCATCCAACCACCT
AACGCACCAGGTAACCCTCCCACGCTGGACGGATATGATGCTCGTTCACGCATCGCCGAGGCCGACAACAAATTT
ACATCAGAACTCGCTACCCGTAAACGTATGATCGAAATAGCCAACGGAGATCGTCAAATCGCAATGCAACGAATT
GAGAGATTCACAGGTGGTGGCAGTAATACCCAAGCGTCGAACAATGGTGCAGTGTCGACAACGACTATGATGTTC
TATATCGCTGCTGGGATTGTATTGATTGTCGCTGTCGGTTTCGGTGTAACGTTCGCTGTTATCAAGGCTGCTGGT
ATTTCTTTGAAAGGTTCGGGGTCAACATAA
Gene >AgabiH39|370300
ATGGGTGCTACGAAATGGCTCGCTCTTCTCCTCTTCCACCCTCTCGAATTCAGGACTCTGCTCCAGTTCTACCTC
TACCATGAGCAGAAGCGTGATATCAAGGCCTTGAAGGAGCACCCGACGTCGGGCTGGGACCGGCAGTCGATGCGG
AGATGTTGGGACTTCCTGGACATGACAAGTAGGAGTTTTTCGGCTGTTATTAAGGAACTAGACGGCGACCTGGCT
CGAACAGTGAGTATTCTTGTCTAGTCTTCCTCGGAGGCTTCATGTTTCATACGCCCGTCGATTTGCTCGTACGAG
GAGCCGGGTAGACTTTGTGGCCACGTCGCCCTATAGGAGGGTATTTGTGCAAGAATCATCCATTTGTTGACGTGG
CTATTATTTTAATCGCCGGAATAGAAGCCCCCTATCACGCCGTCTGTGTATGGACCACGCTGACCATGTGTCTAG
ATATGTCTGTTTTACCTCGTTCTTCGAGGTCTGGACACGATCGAAGATGATATGACCATTCCAGACAAAGTCAAG
CAACCCATTTTACGAAAGTTTCACGAATTAACCGTCGAACATGGATGGAAATTCGACGGTTGCGGTCCTAATGAG
AAGGACCGCCAACTCCTTGTCGAATATGACACAATTGTTGAAGAAGTCAACCGCCTTGACCCTTCGTACGTTTTC
GATTCATCGTTTCCCCAAATATTCTTCTCAAATGCCATGCTTTCTAGCTTCAAAGAGGTCATTATTGACATTTGC
CATAAAATGGAAAATGGCATGGCCGACTTTGCCCATCAAGCCGCAACAACAGGGAAGATTTACATTGCGACCGTC
GCTGAATACGACCTATACTGTCACTACGTCGCAGGCCTCGTCGGTGAGGGGTTATCCCGAATTTTCACCGCATCA
GGGAAAGAAGCCGAGTGGCTTGGTCAGCAGCTCGAGTTATCGAACTCCATGGGACTTCTTCTACAAAAGACCAAC
ATCATCCGTGACTACCGAGAGGACACTGACGATCAACGATATTTCTGGCCCAAAGAAATTTGGGGCAAGTATGGT
TTCAACGAGATGAAGGAAATGTACGCACCAGGGGCATCAGAAAAAGCCCAATGGGTGCAGAGCGGAATGATCTTG
GATGCTCTCAGGCACGCGACTGATGCTTTGGAATATCTCCGATTCTTAAAGAACCAGACCATTTTCAACTTTTGT
GCCATTCCTGCCTCCATGGCTATCGCCACCCTAGAGCTGTGCTTTATGAACTCTGATATGTTCGAGCGGAATATC
AAGATTCGCAAGGCTACTGCCGCTCAGGTAGGTCGCTTTGATTTCACTCCAAGCTTCTACTCAAATTGCATACCT
CATTCCAGCTTATTATGCGGTCTACAAATCCTCGCGATGTTGGTCAGATCTTCTGCGAATACGCTCGTAAAATTC
ATGCAAAAGCCGTCCCGACCGATCCCAACTTCATGCAGATTTCAGTCGCCTGTGGCAAGGTAAACATACACTTAT
TCTATGCAGGTTCACGGAATTAATTTTCATTTTCCTGCAGATTGAACAGTGGTGTGAACAAAATTACCCTTCATT
CATCCAACCACCTAACGCACCAGGTAACCCTCCCACGCTGGACGGATATGATGCTCGTTCACGCATCGCCGAGGC
CGACAACAAATTTACATCAGAACTCGCTACCCGTAAACGTATGATCGAAATAGCCAACGGAGATCGTCAAATCGC
AATGCAACGAATTGAGAGATTCACAGGTGGTGGCAGTAATACCCAAGCGTCGAACAATGGTGCAGTGTCGACAAC
GACTATGATGTTCTATATCGCTGCTGGGATTGTATTGATTGTCGCTGTCGGTTTCGGTGTAACGTTCGCTGTTAT
CAAGGCTGCTGGTATTTCTTTGAAAGGTTCGGGGTCAACATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail