Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|318100
Gene name
Locationscaffold_04:1245977..1247507
Strand-
Gene length (bp)1530
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 1 170 2.0E-29
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 1 190 1.0E-19
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 24 105 4.0E-10
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 11 105 2.0E-09
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 11 105 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 1 170 2.0E-29
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 1 190 1.0E-19
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 24 105 4.0E-10
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 11 105 2.0E-09
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 11 105 2.0E-09
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 463 509 8.0E-07
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 12 105 1.0E-06
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 12 105 1.0E-06
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 12 105 1.0E-06
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 12 105 1.0E-06
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 12 105 1.0E-06
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 12 105 1.0E-06
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 12 105 1.0E-06
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 12 105 1.0E-06
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 12 105 1.0E-06
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 12 105 1.0E-06
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 12 105 1.0E-06
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 12 105 1.0E-06
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 12 105 1.0E-06
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 12 105 1.0E-06
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 12 105 1.0E-06
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 12 105 1.0E-06
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 12 105 1.0E-06
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 12 105 1.0E-06
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 12 105 1.0E-06
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 12 105 1.0E-06
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 12 105 1.0E-06
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 12 105 1.0E-06
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 12 105 1.0E-06
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 12 105 1.0E-06
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 12 105 1.0E-06
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 12 105 1.0E-06
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 12 105 1.0E-06
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 12 105 1.0E-06
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 12 105 1.0E-06
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 12 105 1.0E-06
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 12 105 1.0E-06
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 12 105 1.0E-06
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 12 105 1.0E-06
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 12 105 1.0E-06
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 12 105 1.0E-06
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 12 105 1.0E-06
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 12 105 1.0E-06
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 12 105 1.0E-06
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 12 105 1.0E-06
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 12 105 1.0E-06
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 12 105 2.0E-06
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 12 105 2.0E-06
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 12 105 2.0E-06
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 12 105 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup8064
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|215700
Agaricus bisporus var bisporus H39 AgabiH39|318100 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|394000
Agaricus bisporus var bisporus H39 AgabiH39|397800
Agaricus bisporus var bisporus H39 AgabiH39|399400
Agaricus bisporus var bisporus H97 AgabiH97|027890
Agaricus bisporus var bisporus H97 AgabiH97|039900

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|318100
MLAHKSDAPREMTKVMTLLANSTDRKIKRLRTDRGGEYTNSALQEYLSTNGIKHELSAPNVHQQNGRAERLNRTL
HEKSQAMRKHACLPDSWWGFSMTYAVYIYNRTPMQRVKWKTPYELFYGTKPDLSKIRVFGCGAYVYLPKEIRKNK
LSSRSELMIFLGYQGPNYQFMRHQNRNVIFVSPTALFDEAFLPKCDKSKPGNLERRLSNTPSRSNSSESENSRNG
GEVDFNLDPNSLNGPSTDQPPINRAPPAAPPRPPTPPQPIVPPRQQRAPSPPPRNATPGPSNQPPRQERPTWRKR
CDITPPDESEHNVRRSRRETKVPNRPDNVYGDKHPSKVLRDYERQPFLPDFEEGIQRRVPPRSDRQNARIPTNDQ
ADEARREEIRRHFEQASQRADEYEREHGSQLPSQFGDAPVPGEATMDEVQVLIREGGVRLNNFLFELANQIQTPV
QFKDLTQLPAAMRKKWIDACLEELEALQKRGVYELVDLPKGRRTIKNRWVFNEKSDGRC*
Coding >AgabiH39|318100
ATGCTTGCCCACAAAAGTGATGCACCTCGAGAAATGACGAAAGTCATGACGTTGCTTGCTAACTCCACTGATCGA
AAGATCAAGAGACTGCGCACTGATCGAGGAGGAGAATACACCAATAGTGCTCTACAAGAGTACTTGTCTACCAAC
GGCATTAAACATGAGCTTTCTGCCCCTAATGTTCACCAACAAAATGGACGCGCTGAAAGACTCAATAGAACGTTG
CATGAGAAATCACAAGCCATGCGCAAGCATGCATGCCTTCCCGACTCATGGTGGGGCTTCTCTATGACGTACGCG
GTCTATATTTACAACCGCACGCCTATGCAACGAGTGAAGTGGAAGACTCCGTATGAATTATTCTACGGAACCAAA
CCGGACTTGTCGAAAATCCGAGTGTTTGGCTGTGGTGCTTATGTATATCTTCCAAAAGAAATACGTAAAAACAAG
CTCTCTTCACGATCCGAGCTTATGATATTTTTGGGATACCAAGGCCCAAATTATCAATTTATGAGACACCAAAAC
AGAAATGTAATTTTCGTTTCTCCCACAGCCCTTTTCGATGAAGCTTTTCTTCCGAAATGCGATAAATCGAAACCA
GGTAACCTCGAAAGAAGATTGAGTAATACTCCGAGTCGAAGTAATTCCTCGGAATCAGAGAACTCCAGAAATGGA
GGAGAAGTCGATTTTAATCTCGACCCTAATTCTCTTAATGGTCCCTCTACGGATCAACCACCTATTAATAGAGCT
CCACCGGCAGCACCGCCGCGTCCTCCAACGCCGCCACAGCCGATAGTGCCACCACGGCAACAAAGAGCTCCATCA
CCACCTCCTCGTAATGCAACTCCCGGCCCGTCCAACCAGCCTCCACGGCAGGAACGGCCAACATGGAGAAAACGG
TGTGATATAACTCCGCCTGATGAATCAGAACATAATGTTAGAAGGTCTAGACGGGAAACTAAAGTACCGAACCGA
CCAGATAACGTCTATGGGGATAAACACCCATCAAAAGTTCTGAGAGATTACGAGAGACAACCTTTCTTGCCGGAC
TTCGAAGAAGGAATCCAGCGAAGGGTACCTCCAAGATCTGATAGACAGAACGCTCGTATACCAACCAACGATCAA
GCTGACGAAGCACGTCGCGAAGAAATTCGCAGACACTTCGAACAAGCTAGTCAACGGGCTGACGAATACGAACGA
GAGCATGGCTCTCAACTTCCTTCCCAATTCGGCGATGCTCCGGTCCCTGGAGAAGCCACTATGGACGAAGTTCAA
GTTCTAATCAGAGAAGGAGGAGTAAGGTTAAATAACTTTCTCTTTGAACTTGCAAATCAGATCCAAACGCCAGTC
CAATTTAAGGACTTAACGCAACTACCTGCAGCAATGCGGAAGAAATGGATTGATGCTTGTTTGGAGGAATTAGAA
GCCTTACAGAAACGTGGTGTTTATGAATTAGTAGATCTCCCGAAAGGTCGAAGAACTATTAAAAATAGATGGGTC
TTTAATGAGAAAAGCGATGGCCGCTGTTAG
Transcript >AgabiH39|318100
ATGCTTGCCCACAAAAGTGATGCACCTCGAGAAATGACGAAAGTCATGACGTTGCTTGCTAACTCCACTGATCGA
AAGATCAAGAGACTGCGCACTGATCGAGGAGGAGAATACACCAATAGTGCTCTACAAGAGTACTTGTCTACCAAC
GGCATTAAACATGAGCTTTCTGCCCCTAATGTTCACCAACAAAATGGACGCGCTGAAAGACTCAATAGAACGTTG
CATGAGAAATCACAAGCCATGCGCAAGCATGCATGCCTTCCCGACTCATGGTGGGGCTTCTCTATGACGTACGCG
GTCTATATTTACAACCGCACGCCTATGCAACGAGTGAAGTGGAAGACTCCGTATGAATTATTCTACGGAACCAAA
CCGGACTTGTCGAAAATCCGAGTGTTTGGCTGTGGTGCTTATGTATATCTTCCAAAAGAAATACGTAAAAACAAG
CTCTCTTCACGATCCGAGCTTATGATATTTTTGGGATACCAAGGCCCAAATTATCAATTTATGAGACACCAAAAC
AGAAATGTAATTTTCGTTTCTCCCACAGCCCTTTTCGATGAAGCTTTTCTTCCGAAATGCGATAAATCGAAACCA
GGTAACCTCGAAAGAAGATTGAGTAATACTCCGAGTCGAAGTAATTCCTCGGAATCAGAGAACTCCAGAAATGGA
GGAGAAGTCGATTTTAATCTCGACCCTAATTCTCTTAATGGTCCCTCTACGGATCAACCACCTATTAATAGAGCT
CCACCGGCAGCACCGCCGCGTCCTCCAACGCCGCCACAGCCGATAGTGCCACCACGGCAACAAAGAGCTCCATCA
CCACCTCCTCGTAATGCAACTCCCGGCCCGTCCAACCAGCCTCCACGGCAGGAACGGCCAACATGGAGAAAACGG
TGTGATATAACTCCGCCTGATGAATCAGAACATAATGTTAGAAGGTCTAGACGGGAAACTAAAGTACCGAACCGA
CCAGATAACGTCTATGGGGATAAACACCCATCAAAAGTTCTGAGAGATTACGAGAGACAACCTTTCTTGCCGGAC
TTCGAAGAAGGAATCCAGCGAAGGGTACCTCCAAGATCTGATAGACAGAACGCTCGTATACCAACCAACGATCAA
GCTGACGAAGCACGTCGCGAAGAAATTCGCAGACACTTCGAACAAGCTAGTCAACGGGCTGACGAATACGAACGA
GAGCATGGCTCTCAACTTCCTTCCCAATTCGGCGATGCTCCGGTCCCTGGAGAAGCCACTATGGACGAAGTTCAA
GTTCTAATCAGAGAAGGAGGAGTAAGGTTAAATAACTTTCTCTTTGAACTTGCAAATCAGATCCAAACGCCAGTC
CAATTTAAGGACTTAACGCAACTACCTGCAGCAATGCGGAAGAAATGGATTGATGCTTGTTTGGAGGAATTAGAA
GCCTTACAGAAACGTGGTGTTTATGAATTAGTAGATCTCCCGAAAGGTCGAAGAACTATTAAAAATAGATGGGTC
TTTAATGAGAAAAGCGATGGCCGCTGTTAG
Gene >AgabiH39|318100
ATGCTTGCCCACAAAAGTGATGCACCTCGAGAAATGACGAAAGTCATGACGTTGCTTGCTAACTCCACTGATCGA
AAGATCAAGAGACTGCGCACTGATCGAGGAGGAGAATACACCAATAGTGCTCTACAAGAGTACTTGTCTACCAAC
GGCATTAAACATGAGCTTTCTGCCCCTAATGTTCACCAACAAAATGGACGCGCTGAAAGACTCAATAGAACGTTG
CATGAGAAATCACAAGCCATGCGCAAGCATGCATGCCTTCCCGACTCATGGTGGGGCTTCTCTATGACGTACGCG
GTCTATATTTACAACCGCACGCCTATGCAACGAGTGAAGTGGAAGACTCCGTATGAATTATTCTACGGAACCAAA
CCGGACTTGTCGAAAATCCGAGTGTTTGGCTGTGGTGCTTATGTATATCTTCCAAAAGAAATACGTAAAAACAAG
CTCTCTTCACGATCCGAGCTTATGATATTTTTGGGATACCAAGGCCCAAATTATCAATTTATGAGACACCAAAAC
AGAAATGTAATTTTCGTTTCTCCCACAGCCCTTTTCGATGAAGCTTTTCTTCCGAAATGCGATAAATCGAAACCA
GGTAACCTCGAAAGAAGATTGAGTAATACTCCGAGTCGAAGTAATTCCTCGGAATCAGAGAACTCCAGAAATGGA
GGAGAAGTCGATTTTAATCTCGACCCTAATTCTCTTAATGGTCCCTCTACGGATCAACCACCTATTAATAGAGCT
CCACCGGCAGCACCGCCGCGTCCTCCAACGCCGCCACAGCCGATAGTGCCACCACGGCAACAAAGAGCTCCATCA
CCACCTCCTCGTAATGCAACTCCCGGCCCGTCCAACCAGCCTCCACGGCAGGAACGGCCAACATGGAGAAAACGG
TGTGATATAACTCCGCCTGATGAATCAGAACATAATGTTAGAAGGTCTAGACGGGAAACTAAAGTACCGAACCGA
CCAGATAACGTCTATGGGGATAAACACCCATCAAAAGTTCTGAGAGATTACGAGAGACAACCTTTCTTGCCGGAC
TTCGAAGAAGGAATCCAGCGAAGGGTACCTCCAAGATCTGATAGACAGAACGCTCGTATACCAACCAACGATCAA
GCTGACGAAGCACGTCGCGAAGAAATTCGCAGACACTTCGAACAAGCTAGTCAACGGGCTGACGAATACGAACGA
GAGCATGGCTCTCAACTTCCTTCCCAATTCGGCGATGCTCCGGTCCCTGGAGAAGCCACTATGGACGAAGTTCAA
GTTCTAATCAGAGAAGGAGGAGTAAGGTTAAATAACTTTCTCTTTGAACTTGCAAATCAGATCCAAACGCCAGTC
CAATTTAAGGACTTAACGCAACTACCTGCAGCAATGCGGAAGAAATGGATTGATGCTTGTTTGGAGGAATTAGAA
GCCTTACAGAAACGTGGTGTTTATGAATTAGTAGATCTCCCGAAAGGTCGAAGAACTATTAAAAATAGATGGGTC
TTTAATGAGAAAAGCGATGGCCGCTGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail