Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|306400
Gene name
Locationscaffold_03:3040963..3041717
Strand+
Gene length (bp)754
Transcript length (bp)645
Coding sequence length (bp)645
Protein length (aa) 215

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 3.9E-08 79 141

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999712

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup817
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|306400 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|065230
Rhodonia placenta FPRL280 RhoplFPRL280|330_7
Rhodonia placenta FPRL280 RhoplFPRL280|515_4
Rhodonia placenta FPRL280 RhoplFPRL280|678_1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|306400
MIFNVKLVLLALVSVVAAQSSTESDTSAPGSSSSSSSSSSSSSSAASSAASSTPPATSSSPANVTTTMSGPFPSG
TPAGLTACILDCVSTAASQSECVSFTNLMCVCTSTAFQTAATSCLMANCTQADVTAATNLQMTQCAAVNGSSGAS
TMASNTVSNTASGSGTPIAPPPAGASDMTSPAPSPTAPNGAHMSAASGIWAFAAGLIGIAAAAL*
Coding >AgabiH39|306400
ATGATTTTCAACGTCAAATTGGTTCTCCTGGCCCTCGTTTCCGTAGTGGCAGCCCAGTCTTCAACCGAATCTGAT
ACTAGTGCTCCCGGTTCCTCGTCTTCCTCCTCGTCTTCCTCCTCGTCTTCCTCCTCTGCTGCCTCCTCTGCTGCC
TCATCCACGCCTCCTGCAACATCATCCTCTCCTGCAAATGTTACTACCACTATGAGTGGTCCATTCCCCTCTGGC
ACCCCGGCTGGTCTGACTGCTTGCATCCTCGACTGTGTCTCGACCGCTGCTTCACAGAGTGAATGCGTCAGCTTT
ACCAATCTGATGTGTGTTTGCACGTCTACGGCCTTCCAGACAGCTGCAACCAGCTGCCTGATGGCTAACTGTACT
CAGGCGGACGTCACCGCAGCTACCAACCTCCAAATGACACAATGTGCCGCTGTGAATGGATCTTCTGGTGCCTCT
ACTATGGCTTCTAATACTGTCTCCAATACAGCCTCTGGTAGTGGCACGCCGATCGCCCCTCCCCCAGCTGGGGCA
TCGGACATGACCTCTCCGGCACCCTCACCCACCGCTCCTAATGGTGCTCACATGTCCGCTGCTAGTGGTATTTGG
GCCTTTGCTGCCGGTCTTATAGGAATCGCTGCGGCTGCTCTCTAG
Transcript >AgabiH39|306400
ATGATTTTCAACGTCAAATTGGTTCTCCTGGCCCTCGTTTCCGTAGTGGCAGCCCAGTCTTCAACCGAATCTGAT
ACTAGTGCTCCCGGTTCCTCGTCTTCCTCCTCGTCTTCCTCCTCGTCTTCCTCCTCTGCTGCCTCCTCTGCTGCC
TCATCCACGCCTCCTGCAACATCATCCTCTCCTGCAAATGTTACTACCACTATGAGTGGTCCATTCCCCTCTGGC
ACCCCGGCTGGTCTGACTGCTTGCATCCTCGACTGTGTCTCGACCGCTGCTTCACAGAGTGAATGCGTCAGCTTT
ACCAATCTGATGTGTGTTTGCACGTCTACGGCCTTCCAGACAGCTGCAACCAGCTGCCTGATGGCTAACTGTACT
CAGGCGGACGTCACCGCAGCTACCAACCTCCAAATGACACAATGTGCCGCTGTGAATGGATCTTCTGGTGCCTCT
ACTATGGCTTCTAATACTGTCTCCAATACAGCCTCTGGTAGTGGCACGCCGATCGCCCCTCCCCCAGCTGGGGCA
TCGGACATGACCTCTCCGGCACCCTCACCCACCGCTCCTAATGGTGCTCACATGTCCGCTGCTAGTGGTATTTGG
GCCTTTGCTGCCGGTCTTATAGGAATCGCTGCGGCTGCTCTCTAG
Gene >AgabiH39|306400
ATGATTTTCAACGTCAAATTGGTTCTCCTGGCCCTCGTTTCCGTAGTGGCAGCCCAGTCTTCAACCGAATCTGAT
ACTAGTGCTCCCGGTTCCTCGTCTTCCTCCTCGTCTTCCTCCTCGTCTTCCTCCTCTGCTGCCTCCTCTGCTGCC
TCATCCACGCCTCCTGCAACATCATCCTCTCCTGCAAATGTTACTACCACTATGAGTGGTCCATTCCCCTCTGGC
ACCCCGGCTGGTCTGACTGCTTGCATCCTCGACTGTGTCTCGACCGCTGCTTCACAGAGTGAATGCGTCAGCTTG
TAATTCGTTTCTTTTCGTTCTGTCTTTCGACAACTGACTGTCTCATTACAGTACCAATCTGATGTGTGTTTGCAC
GTCTACGGCCTTCCAGACAGCTGCAACCAGCTGCCTGATGGCTAACTGTACTCAGGCGGACGTCACCGCAGCTAC
CAACCTCCAAATGACACAATGTGCCGCTGGTATGTGGTTATCGACCTAAAATCCGTTCTATCGTGAGGAATAACG
TTTATGAATAGTGAATGGATCTTCTGGTGCCTCTACTATGGCTTCTAATACTGTCTCCAATACAGCCTCTGGTAG
TGGCACGCCGATCGCCCCTCCCCCAGCTGGGGCATCGGACATGACCTCTCCGGCACCCTCACCCACCGCTCCTAA
TGGTGCTCACATGTCCGCTGCTAGTGGTATTTGGGCCTTTGCTGCCGGTCTTATAGGAATCGCTGCGGCTGCTCT
CTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail