Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|281600
Gene name
Locationscaffold_03:454018..457776
Strand+
Gene length (bp)3758
Transcript length (bp)3237
Coding sequence length (bp)3237
Protein length (aa) 1079

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13374 TPR_10 Tetratricopeptide repeat 1.2E-06 748 785
PF13374 TPR_10 Tetratricopeptide repeat 1.1E-10 786 827
PF13374 TPR_10 Tetratricopeptide repeat 9.2E-10 828 869
PF13374 TPR_10 Tetratricopeptide repeat 1.5E-09 870 910
PF13374 TPR_10 Tetratricopeptide repeat 2.2E-11 912 953
PF13374 TPR_10 Tetratricopeptide repeat 2.2E-11 954 995
PF13374 TPR_10 Tetratricopeptide repeat 2.2E-12 996 1037
PF13374 TPR_10 Tetratricopeptide repeat 9.9E-07 1038 1076
PF13424 TPR_12 Tetratricopeptide repeat 6.9E-08 746 809
PF13424 TPR_12 Tetratricopeptide repeat 2.4E-08 842 898
PF13424 TPR_12 Tetratricopeptide repeat 1.8E-08 969 1019
PF13176 TPR_7 Tetratricopeptide repeat 3.1E-02 874 892
PF01734 Patatin Patatin-like phospholipase 2.9E-21 27 229

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 747 1031 1.0E-30
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 747 1029 1.0E-29
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 747 1035 1.0E-28
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 747 1035 1.0E-28
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 747 1029 2.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 747 1031 1.0E-30
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 747 1029 1.0E-29
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 747 1035 1.0E-28
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 747 1035 1.0E-28
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 747 1029 2.0E-28
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 718 1034 2.0E-28
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 821 1072 5.0E-28
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 747 1013 5.0E-28
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 868 1061 1.0E-27
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 868 1061 1.0E-27
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 868 1061 1.0E-27
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 868 1061 2.0E-27
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 822 1059 3.0E-27
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 826 1059 3.0E-27
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 822 1059 3.0E-27
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 670 1035 5.0E-27
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 822 1029 6.0E-27
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 826 1059 7.0E-27
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 868 1061 7.0E-27
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 868 1066 9.0E-27
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 747 1029 1.0E-26
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 868 1078 2.0E-26
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 868 1061 2.0E-26
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 819 1059 3.0E-26
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 747 1029 9.0E-26
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 777 1070 2.0E-25
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 826 1035 2.0E-25
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 822 1036 2.0E-25
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 868 1061 2.0E-25
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 747 1029 2.0E-25
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 868 1061 3.0E-25
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 737 1050 4.0E-25
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 826 1019 5.0E-25
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 868 1061 5.0E-25
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 822 1029 5.0E-25
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 737 1044 7.0E-25
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 868 1061 1.0E-24
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 747 1031 1.0E-24
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 747 1031 2.0E-24
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 737 1025 2.0E-24
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 868 1061 3.0E-24
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 746 947 4.0E-24
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 868 1061 4.0E-24
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 772 1067 5.0E-24
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 772 1067 5.0E-24
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 868 1061 6.0E-24
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 822 1035 7.0E-24
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 826 1026 8.0E-24
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 868 1061 8.0E-24
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 746 945 1.0E-23
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 826 1019 1.0E-23
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 826 1026 1.0E-23
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 868 1061 1.0E-23
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 826 1026 1.0E-23
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 737 1053 1.0E-23
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 826 1019 2.0E-23
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 737 1025 2.0E-23
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 815 1035 4.0E-23
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 747 1029 6.0E-23
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 772 1067 8.0E-23
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 772 1067 9.0E-23
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 772 1067 6.0E-22
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 780 1062 1.0E-21
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 906 1076 4.0E-21
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 910 1076 4.0E-21
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 906 1076 5.0E-21
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 780 990 5.0E-21
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 906 1076 6.0E-21
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 905 1076 6.0E-21
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 746 945 7.0E-21
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 746 945 1.0E-20
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 780 1071 1.0E-20
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 906 1059 2.0E-20
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 747 935 2.0E-20
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 747 942 3.0E-20
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 747 942 3.0E-20
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 747 942 3.0E-20
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 747 935 4.0E-20
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 906 1076 1.0E-19
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 746 945 2.0E-19
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 814 1074 2.0E-19
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 784 984 2.0E-19
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 868 1059 2.0E-19
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 784 977 2.0E-19
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 784 984 2.0E-19
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 735 945 2.0E-19
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 910 1076 3.0E-19
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 784 977 3.0E-19
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 784 984 3.0E-19
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 746 947 3.0E-18
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 746 947 8.0E-18
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 17 336 8.0E-18
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 831 1077 9.0E-18
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 17 305 1.0E-17
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 813 1074 3.0E-17
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 831 1074 8.0E-17
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 746 914 1.0E-16
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 746 912 1.0E-16
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 746 912 1.0E-16
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 832 1053 1.0E-16
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 746 912 3.0E-16
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 746 912 3.0E-16
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 17 305 3.0E-16
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 948 1077 9.0E-14
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 24 305 9.0E-14
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 952 1077 1.0E-13
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 948 1077 1.0E-13
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 945 1077 2.0E-13
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 952 1077 3.0E-13
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 948 1077 4.0E-13
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 947 1077 4.0E-13
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 952 1077 4.0E-13
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 952 1077 4.0E-13
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 952 1077 4.0E-13
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 948 1077 5.0E-13
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 952 1077 5.0E-13
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 952 1077 8.0E-13
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 952 1077 1.0E-12
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 948 1077 3.0E-12
sp|O23180|PLP5_ARATH Patatin-like protein 5 OS=Arabidopsis thaliana GN=PLP5 PE=1 SV=2 21 230 5.0E-10
sp|Q93ZQ3|PLP9_ARATH Probable inactive patatin-like protein 9 OS=Arabidopsis thaliana GN=PLP9 PE=2 SV=1 25 230 5.0E-09
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 818 1048 4.0E-07
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 751 964 5.0E-07
sp|Q6ZJD3|PLP2_ORYSJ Patatin-like protein 2 OS=Oryza sativa subsp. japonica GN=PLP2 PE=3 SV=1 24 308 8.0E-07
sp|A2YW91|PLP2_ORYSI Patatin-like protein 2 OS=Oryza sativa subsp. indica GN=PLP2 PE=3 SV=1 24 308 8.0E-07
sp|A5HK05|APBP2_RAT Amyloid protein-binding protein 2 OS=Rattus norvegicus GN=Appbp2 PE=2 SV=1 902 1016 2.0E-06
sp|A5HK05|APBP2_RAT Amyloid protein-binding protein 2 OS=Rattus norvegicus GN=Appbp2 PE=2 SV=1 972 1077 3.0E-06
sp|Q92624|APBP2_HUMAN Amyloid protein-binding protein 2 OS=Homo sapiens GN=APPBP2 PE=1 SV=2 972 1077 3.0E-06
sp|Q9DAX9|APBP2_MOUSE Amyloid protein-binding protein 2 OS=Mus musculus GN=Appbp2 PE=2 SV=1 972 1077 3.0E-06
sp|Q92624|APBP2_HUMAN Amyloid protein-binding protein 2 OS=Homo sapiens GN=APPBP2 PE=1 SV=2 902 1016 4.0E-06
sp|Q9DAX9|APBP2_MOUSE Amyloid protein-binding protein 2 OS=Mus musculus GN=Appbp2 PE=2 SV=1 902 1015 4.0E-06
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 938 1076 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup243
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016000
Agaricus bisporus var bisporus H39 AgabiH39|474700
Agaricus bisporus var bisporus H39 AgabiH39|447800
Agaricus bisporus var bisporus H39 AgabiH39|447100
Agaricus bisporus var bisporus H39 AgabiH39|373300
Agaricus bisporus var bisporus H39 AgabiH39|481100
Agaricus bisporus var bisporus H39 AgabiH39|281600 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|278300
Agaricus bisporus var bisporus H39 AgabiH39|053070
Agaricus bisporus var bisporus H39 AgabiH39|371700
Agaricus bisporus var bisporus H97 AgabiH97|109720
Agaricus bisporus var bisporus H97 AgabiH97|016000
Agaricus bisporus var bisporus H97 AgabiH97|016120
Agaricus bisporus var bisporus H97 AgabiH97|020470
Agaricus bisporus var bisporus H97 AgabiH97|052840
Agaricus bisporus var bisporus H97 AgabiH97|052910
Agaricus bisporus var bisporus H97 AgabiH97|053070
Agaricus bisporus var bisporus H97 AgabiH97|054350
Agaricus bisporus var bisporus H97 AgabiH97|089750
Agaricus bisporus var bisporus H97 AgabiH97|109860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|281600
MSSNSGSRSTFGALPCESLEGPPLRLLALDGGGIRGLSELLIIREVMHQLMFEENKRRKKDGEESLSVLPKPCGY
FDLIGGTSTGGIIALMLGRLRMDIDTAIKNYDDLAKRVFSAPKRWGDGKFKATTLETAIKSVVKAVTHDSESPLL
EDDQAGLCRTFVCAKNAHDTGIPVLFRTYQSRETHLDCKIWEAARATSAAPTFFKRIEIGRGQPYIDGGLGRNNP
SQVVLEEANALFGARQIGCLVSIGAGEAGVIEIKKPGLCQRYIPTDVIDTLEAITTDCESTHQNMLRHFTNLPNT
YFRINVDQGMQKIKLSKWEKLSNVEAYTSQYMKKVEVAEKLALLVSAIRVPKGQLLLEQLMTPRPLNESVPQARE
RKRCPLPVKSFMGREEIFDKMRRYFELGESTCFSNVFYIDTTNEQTLRTDLEAITPGNTERSVDASLHWLASQHE
GNWLLFFDNADDVNLKLKKFIPQCRSGNILVTTRNRELCHLSAKDGDAKVGAMEHEDAKNLLLDRARAEESDENK
VLAEAIVQELHCFALAISQAGAYVHCHLSLSKYREFYRRHHDKLLQNEEFQGEDPYERAVYATWSLSYDKLNMSA
RSLLQIFSMVHHEGISEEMFEKAASSKEQLEDSELQNKVTELLNELGKRGPDWSWDFKLVIERLRSYSLIEYDDR
NNTYGIHPLVQQWSRSTMAGNRQLMQKCVLSIIGLSISSSFDDQDYKYRRTLLQHISSSRASFDPEQMAPSVLSG
MALVYFEQGHWKDAEALEVVVMEKRKQLLGDDHPDTLTSMGNLAGRYRDQGQWKDAEALQVVVMGKRKQLLGDDH
PDTLTSMANLAATYWNQGQWKKAEALQVVVMEKRKQLLRDDHPDTLTSMGNLASTYRKQGQWKKAEALEEVVTEK
MKRLLGDDHPGTLTVMGNLASTYKKQGRWKEAEALQVVVMEKRKQLLGDDHPDTLTIMGNLATTYWNQGQWKEAE
ALQVVVIEKMKRLFGDDHPDTLTSMGNLATMYSDQGQWKEAEALEVAVMEKTRQLLGDDHPDTLRSMGNLATTYS
NQGLWKEAEALQLVVMETMKRLSGDDYD*
Coding >AgabiH39|281600
ATGTCATCGAACTCGGGATCCCGATCAACATTCGGGGCCCTTCCGTGTGAAAGTTTAGAAGGACCACCTTTGAGG
CTGCTTGCGCTAGATGGCGGTGGGATTCGCGGACTTTCAGAACTACTCATCATCAGAGAAGTTATGCACCAGCTG
ATGTTTGAGGAGAACAAGAGGCGGAAGAAGGACGGTGAAGAATCTCTTAGCGTACTCCCGAAGCCGTGCGGCTAC
TTCGATCTGATTGGTGGTACTAGTACTGGAGGGATAATTGCTTTGATGCTTGGGCGTCTTCGGATGGATATAGAC
ACGGCGATAAAAAACTACGATGATCTGGCAAAACGAGTCTTCTCTGCTCCGAAGCGATGGGGAGATGGAAAATTC
AAAGCGACAACACTCGAAACAGCCATAAAATCTGTCGTGAAGGCAGTAACTCATGACTCCGAGTCACCCTTATTA
GAAGATGATCAAGCTGGGCTCTGCCGAACATTCGTCTGTGCAAAGAACGCCCACGACACGGGCATTCCAGTGCTT
TTCAGGACATACCAGTCTCGTGAAACACATTTAGATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCA
CCCACGTTTTTTAAGCGCATTGAAATTGGGCGGGGCCAGCCCTATATTGATGGTGGACTAGGCCGCAATAATCCG
AGTCAGGTAGTACTGGAAGAAGCCAATGCTCTATTTGGCGCTCGTCAAATCGGGTGCTTGGTGAGCATTGGTGCT
GGAGAGGCCGGAGTAATCGAAATCAAGAAACCTGGATTATGCCAGCGGTACATACCAACCGACGTCATCGATACG
TTAGAGGCAATTACCACCGACTGCGAATCAACACACCAAAATATGTTGCGCCATTTCACCAACTTGCCAAACACC
TATTTTCGAATAAATGTCGACCAGGGGATGCAGAAAATAAAGCTTTCCAAATGGGAGAAATTGAGCAACGTGGAG
GCTTATACATCGCAATATATGAAGAAGGTGGAGGTCGCTGAGAAGCTTGCCTTGTTAGTTAGTGCGATCAGAGTT
CCGAAAGGGCAGCTTCTACTCGAGCAACTCATGACTCCTAGGCCTCTGAATGAATCGGTCCCACAAGCCAGGGAA
CGCAAGCGTTGTCCGCTTCCTGTGAAATCATTTATGGGACGAGAGGAAATCTTTGATAAGATGCGCAGATATTTT
GAGTTGGGGGAATCAACCTGCTTCTCTAATGTCTTCTACATTGACACGACCAATGAACAAACTCTTCGAACAGAC
CTTGAGGCCATCACTCCAGGAAATACAGAGCGATCAGTAGATGCGAGTCTCCATTGGCTTGCAAGCCAGCACGAG
GGGAACTGGCTTCTCTTCTTCGACAACGCGGACGATGTGAACTTGAAACTGAAGAAATTCATTCCTCAGTGTCGA
TCTGGAAACATCCTGGTTACAACACGTAACCGAGAACTTTGCCATCTCTCTGCGAAAGACGGGGATGCAAAGGTT
GGTGCGATGGAGCACGAAGACGCAAAAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGCGATGAAAATAAA
GTGCTGGCAGAGGCAATTGTACAGGAACTCCATTGCTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTACGTTCAC
TGCCACTTGTCATTAAGCAAATATCGAGAATTCTATCGACGTCACCATGACAAACTGTTACAGAACGAAGAGTTT
CAAGGAGAAGATCCATACGAACGAGCGGTGTATGCGACGTGGAGTCTGAGCTACGACAAACTTAACATGTCAGCA
AGATCTTTACTCCAAATATTCTCGATGGTACATCACGAAGGAATTTCGGAGGAAATGTTCGAAAAGGCGGCATCG
TCTAAAGAGCAACTGGAGGATTCCGAACTACAAAACAAAGTGACTGAGTTGTTGAACGAGCTGGGAAAACGAGGT
CCAGACTGGTCTTGGGACTTTAAGCTGGTCATCGAGCGTCTTCGTTCATATTCGCTCATTGAATATGATGATCGA
AACAACACCTACGGCATTCATCCACTAGTACAACAGTGGAGTCGTAGCACCATGGCAGGAAACAGACAGCTCATG
CAGAAATGTGTACTCAGCATCATTGGCCTATCGATTTCTTCGTCATTCGACGACCAGGACTACAAGTATCGACGG
ACACTTTTGCAGCATATCTCCAGCTCCAGAGCCTCCTTCGATCCAGAACAGATGGCCCCTTCAGTTTTGAGTGGT
ATGGCACTTGTGTACTTCGAACAGGGGCACTGGAAGGATGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGG
AAGCAGCTGCTCGGTGATGATCATCCTGACACACTCACGAGCATGGGCAATCTTGCGGGCAGGTACAGAGACCAG
GGGCAGTGGAAGGATGCAGAGGCGCTTCAGGTGGTGGTGATGGGAAAGAGGAAGCAGCTGCTCGGTGATGATCAT
CCTGACACACTCACGAGTATGGCCAATCTTGCGGCCACGTACTGGAACCAGGGGCAGTGGAAGAAAGCAGAGGCG
CTTCAGGTGGTGGTGATGGAGAAGAGGAAGCAGCTGCTCCGTGATGATCATCCTGACACGCTCACGAGCATGGGC
AATCTTGCGTCTACTTATAGGAAACAGGGGCAGTGGAAGAAAGCAGAGGCGCTTGAGGAGGTGGTGACAGAGAAG
ATGAAGCGGCTGCTTGGTGATGATCATCCTGGCACACTCACGGTCATGGGCAATCTTGCGTCTACTTACAAGAAA
CAGGGGCGGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAAAAGAGGAAGCAGCTGCTCGGTGATGAC
CATCCTGACACACTCACGATCATGGGCAATCTTGCGACCACATACTGGAACCAGGGGCAGTGGAAGGAAGCAGAG
GCGCTTCAGGTGGTGGTGATAGAGAAGATGAAGCGGCTGTTCGGTGATGATCATCCTGACACGCTCACGAGCATG
GGCAATCTTGCGACCATGTACTCGGACCAGGGGCAGTGGAAGGAAGCAGAGGCACTTGAGGTGGCGGTGATGGAG
AAGACGAGGCAGCTGCTTGGTGATGATCATCCCGACACGCTCAGGAGCATGGGCAATCTTGCGACCACGTATTCG
AACCAGGGGCTGTGGAAGGAAGCAGAGGCGCTTCAGTTGGTGGTGATGGAGACAATGAAGCGGCTGTCTGGTGAT
GATTATGATTGA
Transcript >AgabiH39|281600
ATGTCATCGAACTCGGGATCCCGATCAACATTCGGGGCCCTTCCGTGTGAAAGTTTAGAAGGACCACCTTTGAGG
CTGCTTGCGCTAGATGGCGGTGGGATTCGCGGACTTTCAGAACTACTCATCATCAGAGAAGTTATGCACCAGCTG
ATGTTTGAGGAGAACAAGAGGCGGAAGAAGGACGGTGAAGAATCTCTTAGCGTACTCCCGAAGCCGTGCGGCTAC
TTCGATCTGATTGGTGGTACTAGTACTGGAGGGATAATTGCTTTGATGCTTGGGCGTCTTCGGATGGATATAGAC
ACGGCGATAAAAAACTACGATGATCTGGCAAAACGAGTCTTCTCTGCTCCGAAGCGATGGGGAGATGGAAAATTC
AAAGCGACAACACTCGAAACAGCCATAAAATCTGTCGTGAAGGCAGTAACTCATGACTCCGAGTCACCCTTATTA
GAAGATGATCAAGCTGGGCTCTGCCGAACATTCGTCTGTGCAAAGAACGCCCACGACACGGGCATTCCAGTGCTT
TTCAGGACATACCAGTCTCGTGAAACACATTTAGATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCA
CCCACGTTTTTTAAGCGCATTGAAATTGGGCGGGGCCAGCCCTATATTGATGGTGGACTAGGCCGCAATAATCCG
AGTCAGGTAGTACTGGAAGAAGCCAATGCTCTATTTGGCGCTCGTCAAATCGGGTGCTTGGTGAGCATTGGTGCT
GGAGAGGCCGGAGTAATCGAAATCAAGAAACCTGGATTATGCCAGCGGTACATACCAACCGACGTCATCGATACG
TTAGAGGCAATTACCACCGACTGCGAATCAACACACCAAAATATGTTGCGCCATTTCACCAACTTGCCAAACACC
TATTTTCGAATAAATGTCGACCAGGGGATGCAGAAAATAAAGCTTTCCAAATGGGAGAAATTGAGCAACGTGGAG
GCTTATACATCGCAATATATGAAGAAGGTGGAGGTCGCTGAGAAGCTTGCCTTGTTAGTTAGTGCGATCAGAGTT
CCGAAAGGGCAGCTTCTACTCGAGCAACTCATGACTCCTAGGCCTCTGAATGAATCGGTCCCACAAGCCAGGGAA
CGCAAGCGTTGTCCGCTTCCTGTGAAATCATTTATGGGACGAGAGGAAATCTTTGATAAGATGCGCAGATATTTT
GAGTTGGGGGAATCAACCTGCTTCTCTAATGTCTTCTACATTGACACGACCAATGAACAAACTCTTCGAACAGAC
CTTGAGGCCATCACTCCAGGAAATACAGAGCGATCAGTAGATGCGAGTCTCCATTGGCTTGCAAGCCAGCACGAG
GGGAACTGGCTTCTCTTCTTCGACAACGCGGACGATGTGAACTTGAAACTGAAGAAATTCATTCCTCAGTGTCGA
TCTGGAAACATCCTGGTTACAACACGTAACCGAGAACTTTGCCATCTCTCTGCGAAAGACGGGGATGCAAAGGTT
GGTGCGATGGAGCACGAAGACGCAAAAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGCGATGAAAATAAA
GTGCTGGCAGAGGCAATTGTACAGGAACTCCATTGCTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTACGTTCAC
TGCCACTTGTCATTAAGCAAATATCGAGAATTCTATCGACGTCACCATGACAAACTGTTACAGAACGAAGAGTTT
CAAGGAGAAGATCCATACGAACGAGCGGTGTATGCGACGTGGAGTCTGAGCTACGACAAACTTAACATGTCAGCA
AGATCTTTACTCCAAATATTCTCGATGGTACATCACGAAGGAATTTCGGAGGAAATGTTCGAAAAGGCGGCATCG
TCTAAAGAGCAACTGGAGGATTCCGAACTACAAAACAAAGTGACTGAGTTGTTGAACGAGCTGGGAAAACGAGGT
CCAGACTGGTCTTGGGACTTTAAGCTGGTCATCGAGCGTCTTCGTTCATATTCGCTCATTGAATATGATGATCGA
AACAACACCTACGGCATTCATCCACTAGTACAACAGTGGAGTCGTAGCACCATGGCAGGAAACAGACAGCTCATG
CAGAAATGTGTACTCAGCATCATTGGCCTATCGATTTCTTCGTCATTCGACGACCAGGACTACAAGTATCGACGG
ACACTTTTGCAGCATATCTCCAGCTCCAGAGCCTCCTTCGATCCAGAACAGATGGCCCCTTCAGTTTTGAGTGGT
ATGGCACTTGTGTACTTCGAACAGGGGCACTGGAAGGATGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGG
AAGCAGCTGCTCGGTGATGATCATCCTGACACACTCACGAGCATGGGCAATCTTGCGGGCAGGTACAGAGACCAG
GGGCAGTGGAAGGATGCAGAGGCGCTTCAGGTGGTGGTGATGGGAAAGAGGAAGCAGCTGCTCGGTGATGATCAT
CCTGACACACTCACGAGTATGGCCAATCTTGCGGCCACGTACTGGAACCAGGGGCAGTGGAAGAAAGCAGAGGCG
CTTCAGGTGGTGGTGATGGAGAAGAGGAAGCAGCTGCTCCGTGATGATCATCCTGACACGCTCACGAGCATGGGC
AATCTTGCGTCTACTTATAGGAAACAGGGGCAGTGGAAGAAAGCAGAGGCGCTTGAGGAGGTGGTGACAGAGAAG
ATGAAGCGGCTGCTTGGTGATGATCATCCTGGCACACTCACGGTCATGGGCAATCTTGCGTCTACTTACAAGAAA
CAGGGGCGGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAAAAGAGGAAGCAGCTGCTCGGTGATGAC
CATCCTGACACACTCACGATCATGGGCAATCTTGCGACCACATACTGGAACCAGGGGCAGTGGAAGGAAGCAGAG
GCGCTTCAGGTGGTGGTGATAGAGAAGATGAAGCGGCTGTTCGGTGATGATCATCCTGACACGCTCACGAGCATG
GGCAATCTTGCGACCATGTACTCGGACCAGGGGCAGTGGAAGGAAGCAGAGGCACTTGAGGTGGCGGTGATGGAG
AAGACGAGGCAGCTGCTTGGTGATGATCATCCCGACACGCTCAGGAGCATGGGCAATCTTGCGACCACGTATTCG
AACCAGGGGCTGTGGAAGGAAGCAGAGGCGCTTCAGTTGGTGGTGATGGAGACAATGAAGCGGCTGTCTGGTGAT
GATTATGATTGA
Gene >AgabiH39|281600
ATGTCATCGAACTCGGGATCCCGATCAACATTCGGGGTCCTCCTTTGCTTATCAGTAACCACTTGTCGCAGCAAA
CAATACTAGGCCCTTCCGTGTGAAAGTTTAGGTACGTGCATGCAGCATGTCATATGTCACTGCCTCATCCTTGGT
CTTAACGATGACTTCTTCCGCAGAAGGACCACCTTTGAGGCTGCTTGCGCTAGGTATACACGTCCTCTCTCACCG
ATAGAGTCACTGACTAGTAAACTCTGAACAGATGGCGGTGGGATTCGCGGACTTTCAGAACTACTCATCATCAGA
GAAGTTATGCACCAGCTGATGTTTGAGGAGAACAAGAGGCGGAAGAAGGACGGTGAAGAATCTCTTAGCGTACTC
CCGAAGCCGTGCGGCTACTTCGATCTGATTGGTGGTACTAGTACTGGAGGGTGCGCTGTGTTATACATCTACAAT
CGTCTCATGTAACTCACATGTATATTACAGGATAATTGCTTTGATGCTTGGGCGTCTTCGGATGGATATAGACAC
GGCGATAAAAAACTACGATGATCTGGCAAAACGAGTCTTCTCTGCTCCGAAGCGATGGGGAGATGGAAAATTCAA
AGCGACAACACTCGAAACAGCCATAAAATCTGTCGTGAAGGCAGTAACTCATGACTCCGAGTCACCCTTATTAGA
AGATGATCAAGCTGGGCTCTGCCGAACGTGAGTATATTACTTACTCTTCCATGCATTTGGACTTTGAATTCGAAG
ATTTATTAGATTCGTCTGTGCAAAGAACGCCCACGACACGGGCATTCCAGTGCTTTTCAGGACATACCAGTCTCG
TGAAACACATTTAGATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCACCCACGTTTTTTAAGCGCAT
TGAAATTGGGCGGGGCCAGCCCTATATTGATGGTGGACTAGGCCGCAATAATCCGAGTCAGGTAGTACTGGAAGA
AGCCAATGCTCTATTTGGCGCTCGTCAAATCGGGTGCTTGGTGAGCATTGGTGCTGGAGAGGCCGGAGTAATCGA
AATCAAGAAACCTGGATTATGCCAGCGGTACATACCAACCGACGTCATCGATACGTTAGAGGCAATTACCACCGA
CTGCGAATCAACACACCAAAATATGTTGCGCCATTTCACCAACTTGCCAAACACCTATTTTCGAATAAATGTCGA
CCAGGGGATGCAGAAAATAAAGCTTTCCAAATGGGAGAAATTGAGCAACGTGGAGGCTTATACATCGCAATATAT
GAAGAAGGTGGAGGTCGCTGAGAAGCTTGCCTTGTTAGTTAGTGCGATCAGAGTTCCGAAAGGGCAGCTTCTACT
CGAGCAACTCAGTATGGAAGAATCGCTCATATAGATTTTCATAATGATCTAATCTCGTTACCCTAGTGACTCCTA
GGCCTCTGAATGAATCGGTCCCACAAGCCAGGGAACGCAAGCGTTGTCCGCTTCCTGTGAAATCATTTATGGGAC
GAGAGGAAATCTTTGATAAGATGCGCAGATATTTTGAGTTGGGGGGTGATTCTGGATGCGTCTTCGTTTTACATG
GCCTTGGGGTTCCGGCAAGACCCAAATTGCTCTCAAATTTGTGCAAGAATCAACCTGGTATGATCCCACTCTCTA
CACGACTGGCGACAATTTATATGTTTCCTTTCCAGCTTCTCTAATGTCTTCTACATTGACACGACCAATGAACAA
ACTCTTCGAACAGACCTTGAGGCCATCACTCCAGGAAATACAGAGCGATCAGTAGATGCGAGTCTCCATTGGCTT
GCAAGCCAGCACGAGGGGAACTGGCTTCTCTTCTTCGACAACGCGGACGATGTGAACTTGAAACTGAAGAAATTC
ATTCCTCAGTGTCGATCTGGAAACATCCTGGTTACAACACGTAACCGAGAACTTTGCCATCTCTCTGCGAAAGAC
GGGGATGCAAAGGTTGGTGCGATGGAGCACGAAGACGCAAAAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGAG
AGCGATGAAAATAAAGTGCTGGCAGAGGCAATTGTACAGGTTCTTCTTCTCATTTTCGTGCGTTAGAAACGCTTT
CAGTCTAAAGCACGAAACAGGAACTCCATTGCTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTACGTTCACTGCC
ACTTGTCATTAAGCAAATATCGAGAATTCTATCGACGTCACCATGACAAACTGTTACAGAACGAAGAGTTTCAAG
GAGAAGATCCATACGAACGAGCGGTGTATGCGACGTGGAGTCTGAGCTACGACAAACTTAACATGTCAGCAAGAT
CTTTACTCCAAATATTCTCGATGGTACATCACGAAGGAATTTCGGAGGAAATGTTCGAAAAGGCGGCATCGTCTA
AAGAGCAACTGGAGGATTCCGAACTACAAAACAAAGTGACTGAGTTGTTGAACGAGCTGGGAAAACGAGGTCCAG
ACTGGTCTTGGGACTTTAAGCTGGTCATCGAGCGTCTTCGTTCATATTCGCTCATTGAATATGATGATCGAAACA
ACACCTACGGCATTCATCCACTAGTACAACAGTGGAGTCGTAGCACCATGGCAGGAAACAGACAGCTCATGCAGA
AATGTGTACTCAGCATCATTGGCCTATCGATTTCTTCGTCATTCGACGACCAGGACTACAAGTATCGACGGACAC
TTTTGCAGCATATCTCCAGCTCCAGAGCCTCCTTCGATCCAGAACAGATGGCCCCTTCAGTTTTGAGTGGTATGG
CACTTGTGTACTTCGAACAGGGGCACTGGAAGGATGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGC
AGCTGCTCGGTGATGATCATCCTGACACACTCACGAGCATGGGCAATCTTGCGGGCAGGTACAGAGACCAGGGGC
AGTGGAAGGATGCAGAGGCGCTTCAGGTGGTGGTGATGGGAAAGAGGAAGCAGCTGCTCGGTGATGATCATCCTG
ACACACTCACGAGTATGGCCAATCTTGCGGCCACGTACTGGAACCAGGGGCAGTGGAAGAAAGCAGAGGCGCTTC
AGGTGGTGGTGATGGAGAAGAGGAAGCAGCTGCTCCGTGATGATCATCCTGACACGCTCACGAGCATGGGCAATC
TTGCGTCTACTTATAGGAAACAGGGGCAGTGGAAGAAAGCAGAGGCGCTTGAGGAGGTGGTGACAGAGAAGATGA
AGCGGCTGCTTGGTGATGATCATCCTGGCACACTCACGGTCATGGGCAATCTTGCGTCTACTTACAAGAAACAGG
GGCGGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAAAAGAGGAAGCAGCTGCTCGGTGATGACCATC
CTGACACACTCACGATCATGGGCAATCTTGCGACCACATACTGGAACCAGGGGCAGTGGAAGGAAGCAGAGGCGC
TTCAGGTGGTGGTGATAGAGAAGATGAAGCGGCTGTTCGGTGATGATCATCCTGACACGCTCACGAGCATGGGCA
ATCTTGCGACCATGTACTCGGACCAGGGGCAGTGGAAGGAAGCAGAGGCACTTGAGGTGGCGGTGATGGAGAAGA
CGAGGCAGCTGCTTGGTGATGATCATCCCGACACGCTCAGGAGCATGGGCAATCTTGCGACCACGTATTCGAACC
AGGGGCTGTGGAAGGAAGCAGAGGCGCTTCAGTTGGTGGTGATGGAGACAATGAAGCGGCTGTCTGGTGATGATT
ATGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail