Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|278300
Gene name
Locationscaffold_03:77120..82517
Strand-
Gene length (bp)5397
Transcript length (bp)4782
Coding sequence length (bp)4782
Protein length (aa) 1594

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13374 TPR_10 Tetratricopeptide repeat 6.9E-08 772 810
PF13374 TPR_10 Tetratricopeptide repeat 5.0E-09 811 852
PF13374 TPR_10 Tetratricopeptide repeat 5.8E-11 853 894
PF13374 TPR_10 Tetratricopeptide repeat 1.0E-11 895 936
PF13374 TPR_10 Tetratricopeptide repeat 4.1E-06 937 977
PF13374 TPR_10 Tetratricopeptide repeat 2.3E-12 979 1020
PF13374 TPR_10 Tetratricopeptide repeat 1.5E-10 1021 1062
PF13374 TPR_10 Tetratricopeptide repeat 4.8E-11 1063 1104
PF13374 TPR_10 Tetratricopeptide repeat 1.5E-08 1105 1146
PF13374 TPR_10 Tetratricopeptide repeat 1.5E-10 1147 1188
PF13374 TPR_10 Tetratricopeptide repeat 4.8E-09 1189 1228
PF13374 TPR_10 Tetratricopeptide repeat 1.8E-13 1231 1272
PF13374 TPR_10 Tetratricopeptide repeat 2.9E-11 1273 1314
PF13374 TPR_10 Tetratricopeptide repeat 2.3E-09 1315 1355
PF13374 TPR_10 Tetratricopeptide repeat 4.1E-13 1357 1398
PF13374 TPR_10 Tetratricopeptide repeat 7.9E-10 1401 1440
PF13374 TPR_10 Tetratricopeptide repeat 8.4E-09 1441 1482
PF13374 TPR_10 Tetratricopeptide repeat 4.9E-07 1483 1524
PF13374 TPR_10 Tetratricopeptide repeat 5.2E-04 1528 1565
PF13424 TPR_12 Tetratricopeptide repeat 2.7E-08 771 834
PF13424 TPR_12 Tetratricopeptide repeat 1.1E-12 981 1044
PF13424 TPR_12 Tetratricopeptide repeat 1.0E-12 1189 1254
PF13424 TPR_12 Tetratricopeptide repeat 1.3E-07 1329 1380
PF13424 TPR_12 Tetratricopeptide repeat 1.9E-13 1357 1422
PF13176 TPR_7 Tetratricopeptide repeat 3.3E-02 983 1003
PF01734 Patatin Patatin-like phospholipase 3.1E-19 25 227

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1098 1390 4.0E-34
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1099 1392 2.0E-33
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1099 1396 1.0E-32
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1103 1396 2.0E-32
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1019 1306 3.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1098 1390 4.0E-34
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1099 1392 2.0E-33
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1099 1396 1.0E-32
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1103 1396 2.0E-32
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1019 1306 3.0E-32
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1099 1396 9.0E-32
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1103 1392 1.0E-31
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1019 1311 2.0E-31
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 1103 1390 5.0E-31
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1096 1390 6.0E-31
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 1103 1390 1.0E-30
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1019 1311 2.0E-30
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 1019 1322 2.0E-30
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1019 1343 3.0E-30
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 1019 1322 3.0E-30
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1019 1343 6.0E-30
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1232 1474 8.0E-30
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 805 1098 1.0E-29
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 1099 1396 1.0E-29
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1266 1558 2.0E-29
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 805 1133 2.0E-29
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 1099 1390 2.0E-29
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 712 1133 3.0E-29
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1019 1343 3.0E-29
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1019 1306 3.0E-29
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 1019 1335 5.0E-29
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 1019 1322 7.0E-29
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1232 1476 1.0E-28
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1267 1564 1.0E-28
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 1019 1322 1.0E-28
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 804 1096 2.0E-28
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 805 1133 2.0E-28
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 809 1096 2.0E-28
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1232 1430 4.0E-28
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1232 1430 5.0E-28
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1232 1430 5.0E-28
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 1099 1392 5.0E-28
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1232 1476 6.0E-28
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 805 1098 6.0E-28
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 1019 1344 7.0E-28
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1267 1560 8.0E-28
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1271 1564 1.0E-27
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1267 1564 1.0E-27
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1099 1392 1.0E-27
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 1031 1408 1.0E-27
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1267 1560 2.0E-27
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1220 1516 2.0E-27
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1019 1322 2.0E-27
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1267 1558 3.0E-27
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 805 1098 3.0E-27
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 802 1096 5.0E-27
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 1031 1415 5.0E-27
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 930 1222 8.0E-27
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 805 1096 8.0E-27
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 805 1134 9.0E-27
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 856 1218 2.0E-26
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 1192 1565 2.0E-26
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 1075 1386 2.0E-26
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 809 1098 3.0E-26
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 1271 1558 3.0E-26
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 842 1180 3.0E-26
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 805 1096 3.0E-26
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 1232 1439 3.0E-26
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 1224 1565 5.0E-26
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 1065 1386 5.0E-26
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 851 1137 6.0E-26
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 893 1180 7.0E-26
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 1267 1558 7.0E-26
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 1267 1583 9.0E-26
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 1075 1406 9.0E-26
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 1271 1558 1.0E-25
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 1267 1560 1.0E-25
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1232 1430 1.0E-25
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 765 1054 2.0E-25
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 1267 1558 2.0E-25
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 1206 1576 2.0E-25
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 856 1218 2.0E-25
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 787 1187 2.0E-25
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 1232 1490 3.0E-25
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 1187 1490 3.0E-25
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 1150 1489 3.0E-25
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1232 1429 3.0E-25
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 1232 1430 4.0E-25
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 815 1179 4.0E-25
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 857 1218 4.0E-25
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 846 1187 5.0E-25
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 1140 1470 5.0E-25
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1232 1422 5.0E-25
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 1277 1586 6.0E-25
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1232 1422 6.0E-25
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1232 1429 6.0E-25
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1232 1429 6.0E-25
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1271 1486 7.0E-25
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1271 1486 8.0E-25
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 1057 1390 9.0E-25
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1267 1464 9.0E-25
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1271 1486 9.0E-25
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 1224 1554 1.0E-24
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 1276 1586 1.0E-24
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1145 1345 1.0E-24
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 931 1230 2.0E-24
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1103 1303 2.0E-24
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1271 1464 2.0E-24
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1271 1464 2.0E-24
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1145 1362 2.0E-24
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1145 1362 2.0E-24
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1145 1338 3.0E-24
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1145 1338 3.0E-24
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 931 1227 4.0E-24
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 1276 1586 4.0E-24
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1103 1303 4.0E-24
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 1192 1554 5.0E-24
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 815 1204 5.0E-24
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1103 1296 5.0E-24
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1103 1303 5.0E-24
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 771 1015 6.0E-24
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 1146 1486 6.0E-24
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1103 1296 6.0E-24
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 857 1218 7.0E-24
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 931 1237 1.0E-23
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 1277 1586 1.0E-23
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 931 1231 2.0E-23
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 856 1179 2.0E-23
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1019 1219 2.0E-23
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 1224 1554 3.0E-23
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1019 1219 3.0E-23
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 935 1237 4.0E-23
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1348 1568 4.0E-23
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1019 1219 4.0E-23
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1019 1212 5.0E-23
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1019 1212 5.0E-23
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 771 1015 1.0E-22
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1392 1586 3.0E-22
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1061 1278 4.0E-22
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 19 334 5.0E-22
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 936 1254 1.0E-21
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 983 1302 1.0E-21
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1061 1278 1.0E-21
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1061 1278 1.0E-21
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1393 1586 2.0E-21
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 931 1182 2.0E-21
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 940 1254 2.0E-21
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 980 1206 2.0E-21
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1187 1380 2.0E-21
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1061 1254 2.0E-21
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1015 1254 2.0E-21
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1397 1586 3.0E-21
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1393 1586 3.0E-21
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 776 1103 3.0E-21
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 19 334 3.0E-21
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1390 1582 4.0E-21
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1187 1402 4.0E-21
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1187 1402 4.0E-21
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 19 303 5.0E-21
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1355 1548 7.0E-21
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 851 1044 8.0E-21
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 851 1044 9.0E-21
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1397 1582 1.0E-20
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 809 1009 1.0E-20
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1355 1548 1.0E-20
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 893 1118 1.0E-20
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 980 1189 1.0E-20
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 851 1051 1.0E-20
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 851 1051 1.0E-20
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 980 1189 1.0E-20
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 768 1015 2.0E-20
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 893 1118 2.0E-20
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 809 1002 2.0E-20
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1355 1548 2.0E-20
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 980 1238 2.0E-20
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 809 1002 2.0E-20
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 893 1086 2.0E-20
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 809 1009 2.0E-20
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 809 1026 2.0E-20
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1355 1555 3.0E-20
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 893 1093 3.0E-20
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 893 1093 3.0E-20
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1355 1555 3.0E-20
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1271 1506 4.0E-20
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1393 1586 5.0E-20
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 980 1170 5.0E-20
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 1393 1582 6.0E-20
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 1397 1582 1.0E-19
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 771 1018 1.0E-19
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1271 1506 1.0E-19
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1393 1582 2.0E-19
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 1393 1582 4.0E-19
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1313 1513 4.0E-19
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1313 1513 5.0E-19
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 1393 1582 8.0E-19
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1397 1578 1.0E-18
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 935 1135 2.0E-18
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1397 1578 2.0E-18
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1329 1578 3.0E-18
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 771 925 4.0E-18
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 935 1128 4.0E-18
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 935 1128 4.0E-18
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 935 1135 4.0E-18
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1397 1578 4.0E-18
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 935 1135 4.0E-18
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1397 1578 4.0E-18
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 22 331 5.0E-18
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 771 918 8.0E-18
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 771 918 1.0E-17
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 771 925 1.0E-17
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 771 925 1.0E-17
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 765 967 2.0E-17
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 765 960 3.0E-17
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 765 960 4.0E-17
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 765 967 4.0E-17
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 765 967 5.0E-17
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 749 966 8.0E-16
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 749 966 6.0E-15
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 773 1061 1.0E-14
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 773 1002 1.0E-14
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 749 966 1.0E-14
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 773 1061 2.0E-14
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 762 1050 2.0E-14
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 771 970 6.0E-14
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 749 966 1.0E-13
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 783 1002 1.0E-13
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 762 1050 1.0E-13
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 1439 1590 2.0E-13
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 1439 1590 2.0E-13
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 772 966 2.0E-13
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 773 1002 2.0E-13
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 1430 1590 4.0E-13
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 762 1050 4.0E-13
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1430 1582 2.0E-12
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1397 1582 2.0E-12
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1439 1582 4.0E-12
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1439 1582 5.0E-12
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1439 1582 5.0E-12
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1439 1582 5.0E-12
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 1435 1590 9.0E-12
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1430 1582 1.0E-11
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1435 1590 3.0E-11
sp|B8AQW7|PLP1_ORYSI Patatin-like protein 1 OS=Oryza sativa subsp. indica GN=PLP1 PE=3 SV=1 2 249 1.0E-09
sp|Q84QY3|PLP1_ORYSJ Patatin-like protein 1 OS=Oryza sativa subsp. japonica GN=PLP1 PE=3 SV=1 2 249 3.0E-09
sp|Q93ZQ3|PLP9_ARATH Probable inactive patatin-like protein 9 OS=Arabidopsis thaliana GN=PLP9 PE=2 SV=1 23 224 2.0E-07
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1481 1586 4.0E-07
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1481 1585 7.0E-07
sp|Q92624|APBP2_HUMAN Amyloid protein-binding protein 2 OS=Homo sapiens GN=APPBP2 PE=1 SV=2 1329 1439 7.0E-07
sp|Q9DAX9|APBP2_MOUSE Amyloid protein-binding protein 2 OS=Mus musculus GN=Appbp2 PE=2 SV=1 1329 1439 7.0E-07
sp|A5HK05|APBP2_RAT Amyloid protein-binding protein 2 OS=Rattus norvegicus GN=Appbp2 PE=2 SV=1 1329 1439 7.0E-07
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 1019 1377 8.0E-07
sp|A5HK05|APBP2_RAT Amyloid protein-binding protein 2 OS=Rattus norvegicus GN=Appbp2 PE=2 SV=1 1159 1292 1.0E-06
sp|A5HK05|APBP2_RAT Amyloid protein-binding protein 2 OS=Rattus norvegicus GN=Appbp2 PE=2 SV=1 1244 1376 1.0E-06
sp|Q92624|APBP2_HUMAN Amyloid protein-binding protein 2 OS=Homo sapiens GN=APPBP2 PE=1 SV=2 1159 1292 2.0E-06
sp|Q92624|APBP2_HUMAN Amyloid protein-binding protein 2 OS=Homo sapiens GN=APPBP2 PE=1 SV=2 1244 1376 2.0E-06
sp|Q9DAX9|APBP2_MOUSE Amyloid protein-binding protein 2 OS=Mus musculus GN=Appbp2 PE=2 SV=1 1159 1292 2.0E-06
sp|Q9DAX9|APBP2_MOUSE Amyloid protein-binding protein 2 OS=Mus musculus GN=Appbp2 PE=2 SV=1 1244 1376 2.0E-06
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 1203 1451 2.0E-06
sp|A5HK05|APBP2_RAT Amyloid protein-binding protein 2 OS=Rattus norvegicus GN=Appbp2 PE=2 SV=1 1076 1208 3.0E-06
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 1065 1236 4.0E-06
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 1481 1586 5.0E-06
sp|Q92624|APBP2_HUMAN Amyloid protein-binding protein 2 OS=Homo sapiens GN=APPBP2 PE=1 SV=2 1076 1208 5.0E-06
sp|Q9DAX9|APBP2_MOUSE Amyloid protein-binding protein 2 OS=Mus musculus GN=Appbp2 PE=2 SV=1 1076 1208 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup243
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016000
Agaricus bisporus var bisporus H39 AgabiH39|474700
Agaricus bisporus var bisporus H39 AgabiH39|447800
Agaricus bisporus var bisporus H39 AgabiH39|447100
Agaricus bisporus var bisporus H39 AgabiH39|373300
Agaricus bisporus var bisporus H39 AgabiH39|481100
Agaricus bisporus var bisporus H39 AgabiH39|281600
Agaricus bisporus var bisporus H39 AgabiH39|278300 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|053070
Agaricus bisporus var bisporus H39 AgabiH39|371700
Agaricus bisporus var bisporus H97 AgabiH97|109720
Agaricus bisporus var bisporus H97 AgabiH97|016000
Agaricus bisporus var bisporus H97 AgabiH97|016120
Agaricus bisporus var bisporus H97 AgabiH97|020470
Agaricus bisporus var bisporus H97 AgabiH97|052840
Agaricus bisporus var bisporus H97 AgabiH97|052910
Agaricus bisporus var bisporus H97 AgabiH97|053070
Agaricus bisporus var bisporus H97 AgabiH97|054350
Agaricus bisporus var bisporus H97 AgabiH97|089750
Agaricus bisporus var bisporus H97 AgabiH97|109860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|278300
MGCHPAQGTRNPDQRSGLGPPLRLLALDGGGIRGLSELLILKEVMHKLMIEENENRKKDGQGPLNALPKPCDYFD
LIGGTSTGGIIALMLGRLRMDVETAITKYDDLAKQVFSAKKQWGDGAFKVTTLEAAMKSVVETVTGDSESLLLES
DQGEVCLTFVCAKNAHNMDSPVLFRTYQSRETHFNCKIWEAARATSAAPKFFKRIVIGRNQPFIDGGLGRNNPSQ
VVLEEASALFGARQFGCLVSIGTGQAEITKIKEPGLYQRIIPTGVIGALKAISTDCESTHQTMLRRFANLPNTYF
RLNVDQGMQGIQFSQWEKLSNVEAHTAQYMQKVEVAEKLPLLVSAIRVPRGQLLLEQLITPRPPNESVPRARERK
PCPLPVKYFKGREEILDKMRKYFELGDDSPHVFVLHGLGGSGKTQIASKFVQESTCFSDVFYIDATNEQTLRTDL
EAIVPGNTERSVDASLHWLASQPEGNWLLFFDNADDVNLKLKKFIPQCRSGNILVTTRNRELRHLSAKDGDLNVG
AMEDEDAKNLLLDRARAEASGENKILAGAIVQELHYFALAISQAGAYIHCRRLSLSKYRELYQRHRDKLLQNEEL
QGDDPYERAVYATWSLSYNKLGASARSLLQIFSVLHHEGISEEMFEKAASSEEQLEDSELQNKVTELLNELGTRG
PDWSWDFGQVIERLGSYSLIEYDDRNHTYSIHPLVQQWSRSTMAEKQQLMQKCVLSIIGLSISSTLNNQDYKYRR
TLLQHISSSRASIDPAQMTPSVLSHLACVYSEQGQWKEAGALEVVVMAKRKQLLGDDHPDTLMSMNNLASTYTKQ
GMWKEAEALQVVVTEKAKQLLGDDHPHTLTSMANLASAYRDQGKWKEAEALEVVVMEKAKQLLGDDHPHTLTSMA
NLASAYRDQGKWKEAEALQVVVMEKTKQLLGNDHPDTLTSMAKLASTYSDQGQWKEAEALQVVVMEKTKQLLRDD
HAHTLMSMNNLASTYWNQGQWKEAEALLVVVVEKTKELLDDDHPDTLRSMNNLASTYWIQGQWKKAEALQVVVME
KAKQLLGDDHPHTLRSMANLACSYRDQGQLKEAEALEVVVMEKRKQLLGDDHPDTLKSMVNLASTYRKQGQWKEA
EALQVVVMEKTKQLRGDDHPDTLTSMANLASTYSDQGQWKEAEALQVVVMEKKKQLLGDGHPDTLMSMNNLASTY
SKQGMWKEAEALQVVVMEKAKQLLGDDHAQTIMSMNNLASTYYDQGQWKEAEELQVVVVEKTKRLLGHDHPDTLT
SMDNLASMYKNQGKWKEAEALQVVVMEKTKQLLGDDHPHTLTSMADLASTYWNQRQWKEAEELQVVVMEKTKQLL
GDDHPRTLTSMNNLASMYKSQGKWKEAEALQVLVMEKRKQLLGDDHPDTFTSMNNLASTYWIQGQWKKAEALQVV
VMEKAKQLLGDDHPHTLTSMANLALTYGKQEQWKEAEVLQVVVMEKRKQLLGDGHPDTLTSMADLALTYGKQEQW
KEAEALQVVVMEKTKQLRGDDHPDTVLSMVKLALTYVNQGQWKEAEALKVVFMEKRKQLLGDDHPRTLMSKANLA
ATYRTRGSGKKQRRFRWW*
Coding >AgabiH39|278300
ATGGGATGCCATCCAGCACAAGGAACTCGCAATCCCGATCAGCGTTCTGGTTTAGGACCGCCTTTGAGGCTGCTT
GCGCTAGATGGTGGTGGAATACGCGGACTATCAGAACTACTCATCCTCAAAGAAGTTATGCACAAGCTGATGATT
GAGGAGAACGAGAACCGGAAGAAGGACGGTCAAGGGCCTCTTAATGCACTCCCGAAGCCGTGCGATTACTTCGAT
CTGATTGGTGGTACTAGTACTGGAGGGATAATTGCTTTGATGCTTGGGCGTCTTCGGATGGATGTAGAGACAGCA
ATCACAAAGTACGATGACCTGGCGAAACAGGTCTTCTCCGCTAAGAAGCAATGGGGAGACGGAGCATTCAAAGTG
ACAACACTCGAAGCAGCCATGAAATCTGTCGTAGAGACCGTAACTGGTGATTCCGAATCACTCTTATTAGAAAGT
GATCAAGGTGAAGTCTGCCTAACTTTCGTCTGTGCTAAGAATGCCCATAACATGGACTCTCCAGTGCTTTTCAGG
ACATACCAGTCTCGTGAAACACATTTCAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCGCCGAAG
TTTTTTAAGCGCATTGTTATTGGGCGGAACCAGCCCTTTATCGATGGTGGACTAGGCCGCAATAATCCGAGTCAG
GTGGTACTGGAAGAAGCCAGTGCTCTATTTGGCGCTCGTCAATTTGGGTGCTTGGTGAGCATTGGTACTGGACAG
GCCGAAATAACCAAGATCAAGGAGCCTGGGTTATACCAGCGGATCATACCAACCGGCGTCATCGGTGCGTTAAAG
GCAATTAGCACCGACTGCGAATCAACACACCAAACAATGTTGCGCCGTTTCGCCAACTTGCCGAACACCTACTTT
CGACTAAATGTCGACCAGGGGATGCAGGGAATACAGTTTTCCCAATGGGAGAAATTGAGCAACGTGGAGGCTCAT
ACAGCGCAATATATGCAGAAGGTGGAGGTCGCTGAGAAGCTTCCCTTGTTGGTTAGTGCGATCAGAGTCCCGAGA
GGGCAGCTTCTACTCGAGCAACTCATTACTCCTAGGCCTCCAAATGAATCGGTCCCACGAGCCAGGGAACGCAAG
CCTTGTCCGCTTCCTGTGAAATATTTTAAAGGGCGAGAGGAAATCCTTGATAAGATGCGCAAATATTTTGAGTTG
GGGGATGATTCTCCGCATGTCTTCGTTTTGCATGGTCTTGGGGGTTCCGGCAAGACCCAAATTGCTTCCAAATTT
GTGCAAGAATCAACCTGCTTCTCCGACGTCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACAGACCTT
GAGGCCATCGTTCCAGGAAATACAGAGCGATCAGTAGATGCGAGTCTCCATTGGCTTGCAAGCCAGCCCGAGGGG
AACTGGCTTCTCTTCTTCGACAACGCGGACGATGTGAACTTGAAACTGAAGAAATTCATTCCTCAGTGTCGATCT
GGAAACATCCTGGTTACAACACGTAATCGAGAGCTTCGCCATCTCTCTGCGAAAGACGGGGATTTAAACGTTGGT
GCGATGGAGGACGAAGACGCAAAAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGCGAGCGGTGAAAACAAAATT
CTGGCAGGGGCAATTGTACAGGAACTCCATTACTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTACATTCATTGC
CGCCGCTTGTCATTAAGCAAATATCGAGAACTCTATCAACGTCACCGTGACAAACTGTTACAGAATGAAGAGTTA
CAAGGAGATGATCCATACGAACGAGCGGTGTATGCGACGTGGAGTTTGAGCTACAACAAACTTGGCGCATCAGCA
AGATCTTTGCTCCAAATTTTCTCGGTGCTACATCACGAAGGAATCTCGGAGGAAATGTTCGAAAAGGCGGCGTCG
TCTGAAGAGCAACTGGAGGATTCCGAACTACAAAACAAAGTGACTGAGCTGTTGAACGAGCTGGGAACACGGGGC
CCAGACTGGTCTTGGGACTTCGGGCAGGTCATCGAGCGCCTTGGTTCATATTCGCTTATTGAATATGACGATCGA
AATCACACCTACAGTATTCATCCGCTAGTACAGCAGTGGAGTCGTAGCACCATGGCGGAAAAGCAACAGCTCATG
CAGAAATGTGTACTCAGCATCATTGGCTTATCGATTTCTTCGACACTCAACAACCAGGACTACAAGTACCGACGC
ACACTTTTGCAGCATATCTCCAGCTCCAGAGCCTCCATCGATCCAGCACAGATGACGCCTTCGGTTTTGAGTCAT
TTGGCATGTGTGTACTCCGAACAGGGGCAGTGGAAGGAAGCAGGGGCGCTTGAGGTGGTGGTGATGGCGAAGAGG
AAGCAGCTGCTCGGTGATGATCATCCTGACACCCTCATGAGCATGAACAATCTTGCGTCTACATACACCAAGCAG
GGGATGTGGAAAGAAGCAGAGGCGCTTCAGGTGGTGGTGACGGAGAAGGCGAAGCAGCTGCTCGGTGATGACCAT
CCTCACACCCTCACGAGCATGGCCAATCTTGCGTCTGCATACAGGGACCAGGGGAAGTGGAAGGAAGCAGAGGCG
CTTGAGGTGGTGGTGATGGAGAAGGCGAAGCAGCTGCTCGGTGATGACCATCCTCACACCCTCACGAGCATGGCC
AATCTTGCGTCTGCATACAGGGACCAGGGGAAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAG
ACGAAGCAGCTGCTCGGTAATGATCATCCTGACACCCTCACGAGCATGGCCAAACTTGCCTCCACATACAGTGAC
CAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACAAAGCAGCTGCTCCGCGATGAT
CATGCTCACACCCTCATGAGCATGAACAATCTTGCGTCTACATACTGGAATCAGGGGCAATGGAAGGAAGCAGAG
GCGCTTCTGGTGGTGGTGGTGGAGAAGACAAAGGAGCTGCTAGATGATGATCATCCTGACACACTCAGGAGCATG
AACAATCTTGCATCTACATACTGGATTCAGGGGCAATGGAAGAAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAG
AAGGCGAAGCAGCTGCTCGGTGATGACCATCCTCACACACTCAGGAGCATGGCCAATCTTGCGTGTTCATACAGG
GACCAGGGGCAGTTGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCAGCTACTCGGTGAT
GATCATCCGGACACACTCAAGAGCATGGTCAATCTTGCGTCTACTTACAGGAAACAAGGGCAGTGGAAGGAAGCA
GAGGCGCTTCAGGTGGTGGTGATGGAGAAGACGAAGCAGCTGCGCGGTGATGATCATCCTGACACCCTCACGAGC
ATGGCCAATCTTGCCTCCACATACAGTGACCAGGGACAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATG
GAGAAGAAGAAGCAGCTACTTGGTGATGGTCATCCGGACACCCTCATGAGCATGAACAATCTTGCGTCTACATAC
TCAAAGCAAGGGATGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGGCGAAGCAGCTGCTCGGT
GATGATCATGCTCAAACCATCATGAGCATGAACAATCTTGCGTCTACATACTACGACCAGGGACAATGGAAGGAA
GCAGAGGAGCTTCAAGTGGTGGTGGTGGAGAAGACAAAGCGGCTGCTCGGTCATGATCATCCTGACACACTCACG
AGCATGGACAATCTTGCATCTATGTACAAGAACCAGGGGAAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTG
ATGGAGAAGACGAAGCAGCTGCTCGGTGATGACCATCCTCACACACTCACAAGCATGGCCGATCTTGCGTCTACA
TACTGGAACCAGAGGCAGTGGAAAGAAGCAGAGGAGCTTCAGGTGGTGGTGATGGAGAAGACAAAGCAGCTGCTT
GGTGATGATCATCCTCGCACACTCACGAGCATGAATAATCTTGCATCTATGTACAAGAGCCAGGGGAAGTGGAAG
GAAGCAGAGGCGCTTCAGGTCTTGGTGATGGAAAAGAGGAAGCAGCTGCTCGGTGATGATCATCCTGACACATTC
ACGAGCATGAACAATCTTGCGTCTACATACTGGATTCAGGGGCAATGGAAGAAAGCAGAGGCGCTTCAGGTGGTG
GTGATGGAGAAGGCGAAGCAGCTGCTCGGTGATGACCATCCTCACACACTCACGAGCATGGCCAATCTTGCGCTC
ACATATGGGAAACAGGAGCAGTGGAAGGAAGCAGAGGTGCTTCAGGTGGTGGTGATGGAGAAGAGGAAGCAGCTG
CTTGGTGATGGTCATCCTGACACCCTCACGAGCATGGCCGATCTTGCGCTCACATATGGGAAACAGGAGCAGTGG
AAGGAAGCGGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACGAAGCAGCTACGCGGTGATGATCATCCTGACACA
GTCTTGAGCATGGTCAAACTTGCGCTCACATATGTGAACCAGGGGCAGTGGAAAGAAGCAGAGGCGCTTAAGGTG
GTATTCATGGAGAAGAGGAAGCAGCTGCTCGGTGATGATCACCCTCGCACACTCATGAGCAAGGCTAATCTTGCG
GCCACGTACAGAACCAGGGGTAGTGGAAAGAAGCAGAGGCGCTTCAGGTGGTGGTGA
Transcript >AgabiH39|278300
ATGGGATGCCATCCAGCACAAGGAACTCGCAATCCCGATCAGCGTTCTGGTTTAGGACCGCCTTTGAGGCTGCTT
GCGCTAGATGGTGGTGGAATACGCGGACTATCAGAACTACTCATCCTCAAAGAAGTTATGCACAAGCTGATGATT
GAGGAGAACGAGAACCGGAAGAAGGACGGTCAAGGGCCTCTTAATGCACTCCCGAAGCCGTGCGATTACTTCGAT
CTGATTGGTGGTACTAGTACTGGAGGGATAATTGCTTTGATGCTTGGGCGTCTTCGGATGGATGTAGAGACAGCA
ATCACAAAGTACGATGACCTGGCGAAACAGGTCTTCTCCGCTAAGAAGCAATGGGGAGACGGAGCATTCAAAGTG
ACAACACTCGAAGCAGCCATGAAATCTGTCGTAGAGACCGTAACTGGTGATTCCGAATCACTCTTATTAGAAAGT
GATCAAGGTGAAGTCTGCCTAACTTTCGTCTGTGCTAAGAATGCCCATAACATGGACTCTCCAGTGCTTTTCAGG
ACATACCAGTCTCGTGAAACACATTTCAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCGCCGAAG
TTTTTTAAGCGCATTGTTATTGGGCGGAACCAGCCCTTTATCGATGGTGGACTAGGCCGCAATAATCCGAGTCAG
GTGGTACTGGAAGAAGCCAGTGCTCTATTTGGCGCTCGTCAATTTGGGTGCTTGGTGAGCATTGGTACTGGACAG
GCCGAAATAACCAAGATCAAGGAGCCTGGGTTATACCAGCGGATCATACCAACCGGCGTCATCGGTGCGTTAAAG
GCAATTAGCACCGACTGCGAATCAACACACCAAACAATGTTGCGCCGTTTCGCCAACTTGCCGAACACCTACTTT
CGACTAAATGTCGACCAGGGGATGCAGGGAATACAGTTTTCCCAATGGGAGAAATTGAGCAACGTGGAGGCTCAT
ACAGCGCAATATATGCAGAAGGTGGAGGTCGCTGAGAAGCTTCCCTTGTTGGTTAGTGCGATCAGAGTCCCGAGA
GGGCAGCTTCTACTCGAGCAACTCATTACTCCTAGGCCTCCAAATGAATCGGTCCCACGAGCCAGGGAACGCAAG
CCTTGTCCGCTTCCTGTGAAATATTTTAAAGGGCGAGAGGAAATCCTTGATAAGATGCGCAAATATTTTGAGTTG
GGGGATGATTCTCCGCATGTCTTCGTTTTGCATGGTCTTGGGGGTTCCGGCAAGACCCAAATTGCTTCCAAATTT
GTGCAAGAATCAACCTGCTTCTCCGACGTCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACAGACCTT
GAGGCCATCGTTCCAGGAAATACAGAGCGATCAGTAGATGCGAGTCTCCATTGGCTTGCAAGCCAGCCCGAGGGG
AACTGGCTTCTCTTCTTCGACAACGCGGACGATGTGAACTTGAAACTGAAGAAATTCATTCCTCAGTGTCGATCT
GGAAACATCCTGGTTACAACACGTAATCGAGAGCTTCGCCATCTCTCTGCGAAAGACGGGGATTTAAACGTTGGT
GCGATGGAGGACGAAGACGCAAAAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGCGAGCGGTGAAAACAAAATT
CTGGCAGGGGCAATTGTACAGGAACTCCATTACTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTACATTCATTGC
CGCCGCTTGTCATTAAGCAAATATCGAGAACTCTATCAACGTCACCGTGACAAACTGTTACAGAATGAAGAGTTA
CAAGGAGATGATCCATACGAACGAGCGGTGTATGCGACGTGGAGTTTGAGCTACAACAAACTTGGCGCATCAGCA
AGATCTTTGCTCCAAATTTTCTCGGTGCTACATCACGAAGGAATCTCGGAGGAAATGTTCGAAAAGGCGGCGTCG
TCTGAAGAGCAACTGGAGGATTCCGAACTACAAAACAAAGTGACTGAGCTGTTGAACGAGCTGGGAACACGGGGC
CCAGACTGGTCTTGGGACTTCGGGCAGGTCATCGAGCGCCTTGGTTCATATTCGCTTATTGAATATGACGATCGA
AATCACACCTACAGTATTCATCCGCTAGTACAGCAGTGGAGTCGTAGCACCATGGCGGAAAAGCAACAGCTCATG
CAGAAATGTGTACTCAGCATCATTGGCTTATCGATTTCTTCGACACTCAACAACCAGGACTACAAGTACCGACGC
ACACTTTTGCAGCATATCTCCAGCTCCAGAGCCTCCATCGATCCAGCACAGATGACGCCTTCGGTTTTGAGTCAT
TTGGCATGTGTGTACTCCGAACAGGGGCAGTGGAAGGAAGCAGGGGCGCTTGAGGTGGTGGTGATGGCGAAGAGG
AAGCAGCTGCTCGGTGATGATCATCCTGACACCCTCATGAGCATGAACAATCTTGCGTCTACATACACCAAGCAG
GGGATGTGGAAAGAAGCAGAGGCGCTTCAGGTGGTGGTGACGGAGAAGGCGAAGCAGCTGCTCGGTGATGACCAT
CCTCACACCCTCACGAGCATGGCCAATCTTGCGTCTGCATACAGGGACCAGGGGAAGTGGAAGGAAGCAGAGGCG
CTTGAGGTGGTGGTGATGGAGAAGGCGAAGCAGCTGCTCGGTGATGACCATCCTCACACCCTCACGAGCATGGCC
AATCTTGCGTCTGCATACAGGGACCAGGGGAAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAG
ACGAAGCAGCTGCTCGGTAATGATCATCCTGACACCCTCACGAGCATGGCCAAACTTGCCTCCACATACAGTGAC
CAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACAAAGCAGCTGCTCCGCGATGAT
CATGCTCACACCCTCATGAGCATGAACAATCTTGCGTCTACATACTGGAATCAGGGGCAATGGAAGGAAGCAGAG
GCGCTTCTGGTGGTGGTGGTGGAGAAGACAAAGGAGCTGCTAGATGATGATCATCCTGACACACTCAGGAGCATG
AACAATCTTGCATCTACATACTGGATTCAGGGGCAATGGAAGAAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAG
AAGGCGAAGCAGCTGCTCGGTGATGACCATCCTCACACACTCAGGAGCATGGCCAATCTTGCGTGTTCATACAGG
GACCAGGGGCAGTTGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCAGCTACTCGGTGAT
GATCATCCGGACACACTCAAGAGCATGGTCAATCTTGCGTCTACTTACAGGAAACAAGGGCAGTGGAAGGAAGCA
GAGGCGCTTCAGGTGGTGGTGATGGAGAAGACGAAGCAGCTGCGCGGTGATGATCATCCTGACACCCTCACGAGC
ATGGCCAATCTTGCCTCCACATACAGTGACCAGGGACAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATG
GAGAAGAAGAAGCAGCTACTTGGTGATGGTCATCCGGACACCCTCATGAGCATGAACAATCTTGCGTCTACATAC
TCAAAGCAAGGGATGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGGCGAAGCAGCTGCTCGGT
GATGATCATGCTCAAACCATCATGAGCATGAACAATCTTGCGTCTACATACTACGACCAGGGACAATGGAAGGAA
GCAGAGGAGCTTCAAGTGGTGGTGGTGGAGAAGACAAAGCGGCTGCTCGGTCATGATCATCCTGACACACTCACG
AGCATGGACAATCTTGCATCTATGTACAAGAACCAGGGGAAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTG
ATGGAGAAGACGAAGCAGCTGCTCGGTGATGACCATCCTCACACACTCACAAGCATGGCCGATCTTGCGTCTACA
TACTGGAACCAGAGGCAGTGGAAAGAAGCAGAGGAGCTTCAGGTGGTGGTGATGGAGAAGACAAAGCAGCTGCTT
GGTGATGATCATCCTCGCACACTCACGAGCATGAATAATCTTGCATCTATGTACAAGAGCCAGGGGAAGTGGAAG
GAAGCAGAGGCGCTTCAGGTCTTGGTGATGGAAAAGAGGAAGCAGCTGCTCGGTGATGATCATCCTGACACATTC
ACGAGCATGAACAATCTTGCGTCTACATACTGGATTCAGGGGCAATGGAAGAAAGCAGAGGCGCTTCAGGTGGTG
GTGATGGAGAAGGCGAAGCAGCTGCTCGGTGATGACCATCCTCACACACTCACGAGCATGGCCAATCTTGCGCTC
ACATATGGGAAACAGGAGCAGTGGAAGGAAGCAGAGGTGCTTCAGGTGGTGGTGATGGAGAAGAGGAAGCAGCTG
CTTGGTGATGGTCATCCTGACACCCTCACGAGCATGGCCGATCTTGCGCTCACATATGGGAAACAGGAGCAGTGG
AAGGAAGCGGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACGAAGCAGCTACGCGGTGATGATCATCCTGACACA
GTCTTGAGCATGGTCAAACTTGCGCTCACATATGTGAACCAGGGGCAGTGGAAAGAAGCAGAGGCGCTTAAGGTG
GTATTCATGGAGAAGAGGAAGCAGCTGCTCGGTGATGATCACCCTCGCACACTCATGAGCAAGGCTAATCTTGCG
GCCACGTACAGAACCAGGGGTAGTGGAAAGAAGCAGAGGCGCTTCAGGTGGTGGTGA
Gene >AgabiH39|278300
ATGGGATGCCATCCAGCACAAGGAACTCGCAATCCCGATCAGCGTTCTGGGTCCCCTTTCGCTTCTCAATAACCA
GTTGTTGCAGCAAACAGTACTAGGCCTTTCCGTGTGAAAGTTTAGGTGCGTGCATGCAGCATGTCATATGTCACA
GCCTCGAGGCTCGATCCTTACTCTTAACGATGACCTCTTCTGCAAAAGGACCGCCTTTGAGGCTGCTTGCGCTAG
GTATATGCGTTCGTTTGCACTCTCTCACCGATAGAGTCGCTAACTAGTAAACTCTGAACAGATGGTGGTGGAATA
CGCGGACTATCAGAACTACTCATCCTCAAAGAAGTTATGCACAAGCTGATGATTGAGGAGAACGAGAACCGGAAG
AAGGACGGTCAAGGGCCTCTTAATGCACTCCCGAAGCCGTGCGATTACTTCGATCTGATTGGTGGTACTAGTACT
GGAGGGTGCGCTGCGTTATACACCCACAATCGTCTCATCTTACTCACGTGTATATTACAGGATAATTGCTTTGAT
GCTTGGGCGTCTTCGGATGGATGTAGAGACAGCAATCACAAAGTACGATGACCTGGCGAAACAGGTCTTCTCCGC
TAAGAAGCAATGGGGAGACGGAGCATTCAAAGTGACAACACTCGAAGCAGCCATGAAATCTGTCGTAGAGACCGT
AACTGGTGATTCCGAATCACTCTTATTAGAAAGTGATCAAGGTGAAGTCTGCCTAACGTGAGTATATCGCTTACT
CTTCCATGCATTTGGACTTTGAATTTGAAGATTTATTAGTTTCGTCTGTGCTAAGAATGCCCATAACATGGACTC
TCCAGTGCTTTTCAGGACATACCAGTCTCGTGAAACACATTTCAATTGCAAGATTTGGGAGGCCGCTCGAGCGAC
ATCTGCAGCGCCGAAGTTTTTTAAGCGCATTGTTATTGGGCGGAACCAGCCCTTTATCGATGGTGGACTAGGCCG
CAATAATCCGAGTCAGGTGGTACTGGAAGAAGCCAGTGCTCTATTTGGCGCTCGTCAATTTGGGTGCTTGGTGAG
CATTGGTACTGGACAGGCCGAAATAACCAAGATCAAGGAGCCTGGGTTATACCAGCGGATCATACCAACCGGCGT
CATCGGTGCGTTAAAGGCAATTAGCACCGACTGCGAATCAACACACCAAACAATGTTGCGCCGTTTCGCCAACTT
GCCGAACACCTACTTTCGACTAAATGTCGACCAGGGGATGCAGGGAATACAGTTTTCCCAATGGGAGAAATTGAG
CAACGTGGAGGCTCATACAGCGCAATATATGCAGAAGGTGGAGGTCGCTGAGAAGCTTCCCTTGTTGGTTAGTGC
GATCAGAGTCCCGAGAGGGCAGCTTCTACTCGAGCAACTCAGTATGGAAGAATCCCTCATGTAGATCCCCATAAT
AATCTAATCTCGTTACTCTAGTTACTCCTAGGCCTCCAAATGAATCGGTCCCACGAGCCAGGGAACGCAAGCCTT
GTCCGCTTCCTGTGAAATATTTTAAAGGGCGAGAGGAAATCCTTGATAAGATGCGCAAATATTTTGAGTTGGGGG
ATGATTCTCCGCATGTCTTCGTTTTGCATGGTCTTGGGGGTTCCGGCAAGACCCAAATTGCTTCCAAATTTGTGC
AAGAATCAACCTGGTATGATCCTACCCTCTTACAAATTTGCGACTGGCGACAATTTATATGTTTAATTTCCAGCT
TCTCCGACGTCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACAGACCTTGAGGCCATCGTTCCAGGAA
ATACAGAGCGATCAGTAGATGCGAGTCTCCATTGGCTTGCAAGCCAGCCCGAGGGGAACTGGCTTCTCTTCTTCG
ACAACGCGGACGATGTGAACTTGAAACTGAAGAAATTCATTCCTCAGTGTCGATCTGGAAACATCCTGGTTACAA
CACGTAATCGAGAGCTTCGCCATCTCTCTGCGAAAGACGGGGATTTAAACGTTGGTGCGATGGAGGACGAAGACG
CAAAAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGCGAGCGGTGAAAACAAAATTCTGGCAGGGGCAATTGTAC
AGGTTCTTCCTCTCATTTTCGTTTCATTAGGAAACACTTTCAGTCTAAAGCACGAGGCAGGAACTCCATTACTTT
GCTTTGGCTATTTCCCAAGCTGGCGCTTACATTCATTGCCGCCGCTTGTCATTAAGCAAATATCGAGAACTCTAT
CAACGTCACCGTGACAAACTGTTACAGAATGAAGAGTTACAAGGAGATGATCCATACGAACGAGCGGTGTATGCG
ACGTGGAGTTTGAGCTACAACAAACTTGGCGCATCAGCAAGATCTTTGCTCCAAATTTTCTCGGTGCTACATCAC
GAAGGAATCTCGGAGGAAATGTTCGAAAAGGCGGCGTCGTCTGAAGAGCAACTGGAGGATTCCGAACTACAAAAC
AAAGTGACTGAGCTGTTGAACGAGCTGGGAACACGGGGCCCAGACTGGTCTTGGGACTTCGGGCAGGTCATCGAG
CGCCTTGGTTCATATTCGCTTATTGAATATGACGATCGAAATCACACCTACAGTATTCATCCGCTAGTACAGCAG
TGGAGTCGTAGCACCATGGCGGAAAAGCAACAGCTCATGCAGAAATGTGTACTCAGCATCATTGGCTTATCGATT
TCTTCGACACTCAACAACCAGGACTACAAGTACCGACGCACACTTTTGCAGCATATCTCCAGCTCCAGAGCCTCC
ATCGATCCAGCACAGATGACGCCTTCGGTTTTGAGTCATTTGGCATGTGTGTACTCCGAACAGGGGCAGTGGAAG
GAAGCAGGGGCGCTTGAGGTGGTGGTGATGGCGAAGAGGAAGCAGCTGCTCGGTGATGATCATCCTGACACCCTC
ATGAGCATGAACAATCTTGCGTCTACATACACCAAGCAGGGGATGTGGAAAGAAGCAGAGGCGCTTCAGGTGGTG
GTGACGGAGAAGGCGAAGCAGCTGCTCGGTGATGACCATCCTCACACCCTCACGAGCATGGCCAATCTTGCGTCT
GCATACAGGGACCAGGGGAAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGGCGAAGCAGCTG
CTCGGTGATGACCATCCTCACACCCTCACGAGCATGGCCAATCTTGCGTCTGCATACAGGGACCAGGGGAAGTGG
AAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACGAAGCAGCTGCTCGGTAATGATCATCCTGACACC
CTCACGAGCATGGCCAAACTTGCCTCCACATACAGTGACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTG
GTGGTGATGGAGAAGACAAAGCAGCTGCTCCGCGATGATCATGCTCACACCCTCATGAGCATGAACAATCTTGCG
TCTACATACTGGAATCAGGGGCAATGGAAGGAAGCAGAGGCGCTTCTGGTGGTGGTGGTGGAGAAGACAAAGGAG
CTGCTAGATGATGATCATCCTGACACACTCAGGAGCATGAACAATCTTGCATCTACATACTGGATTCAGGGGCAA
TGGAAGAAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGGCGAAGCAGCTGCTCGGTGATGACCATCCTCAC
ACACTCAGGAGCATGGCCAATCTTGCGTGTTCATACAGGGACCAGGGGCAGTTGAAGGAAGCAGAGGCGCTTGAG
GTGGTGGTGATGGAGAAGAGGAAGCAGCTACTCGGTGATGATCATCCGGACACACTCAAGAGCATGGTCAATCTT
GCGTCTACTTACAGGAAACAAGGGCAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACGAAG
CAGCTGCGCGGTGATGATCATCCTGACACCCTCACGAGCATGGCCAATCTTGCCTCCACATACAGTGACCAGGGA
CAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGAAGAAGCAGCTACTTGGTGATGGTCATCCG
GACACCCTCATGAGCATGAACAATCTTGCGTCTACATACTCAAAGCAAGGGATGTGGAAGGAAGCAGAGGCGCTT
CAGGTGGTGGTGATGGAGAAGGCGAAGCAGCTGCTCGGTGATGATCATGCTCAAACCATCATGAGCATGAACAAT
CTTGCGTCTACATACTACGACCAGGGACAATGGAAGGAAGCAGAGGAGCTTCAAGTGGTGGTGGTGGAGAAGACA
AAGCGGCTGCTCGGTCATGATCATCCTGACACACTCACGAGCATGGACAATCTTGCATCTATGTACAAGAACCAG
GGGAAGTGGAAGGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACGAAGCAGCTGCTCGGTGATGACCAT
CCTCACACACTCACAAGCATGGCCGATCTTGCGTCTACATACTGGAACCAGAGGCAGTGGAAAGAAGCAGAGGAG
CTTCAGGTGGTGGTGATGGAGAAGACAAAGCAGCTGCTTGGTGATGATCATCCTCGCACACTCACGAGCATGAAT
AATCTTGCATCTATGTACAAGAGCCAGGGGAAGTGGAAGGAAGCAGAGGCGCTTCAGGTCTTGGTGATGGAAAAG
AGGAAGCAGCTGCTCGGTGATGATCATCCTGACACACTCACGAGCATGAACAATCTTGCATCTATGTACAAGAGC
CAGGGGAAGTGGAAGGAAGCAGAGGCGCTTCAGGTCTTGGTGATGGAAAAGAGGAAGCAGCTGCTCGGTGATGAT
CATCCTGACACATTCACGAGCATGAACAATCTTGCGTCTACATACTGGATTCAGGGGCAATGGAAGAAAGCAGAG
GCGCTTCAGGTGGTGGTGATGGAGAAGGCGAAGCAGCTGCTCGGTGATGACCATCCTCACACACTCACGAGCATG
GCCAATCTTGCGCTCACATATGGGAAACAGGAGCAGTGGAAGGAAGCAGAGGTGCTTCAGGTGGTGGTGATGGAG
AAGAGGAAGCAGCTGCTTGGTGATGGTCATCCTGACACCCTCACGAGCATGGCCGATCTTGCGCTCACATATGGG
AAACAGGAGCAGTGGAAGGAAGCGGAGGCGCTTCAGGTGGTGGTGATGGAGAAGACGAAGCAGCTACGCGGTGAT
GATCATCCTGACACAGTCTTGAGCATGGTCAAACTTGCGCTCACATATGTGAACCAGGGGCAGTGGAAAGAAGCA
GAGGCGCTTAAGGTGGTATTCATGGAGAAGAGGAAGCAGCTGCTCGGTGATGATCACCCTCGCACACTCATGAGC
AAGGCTAATCTTGCGGCCACGTACAGAACCAGGGGTAGTGGAAAGAAGCAGAGGCGCTTCAGGTGGTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail