Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|270400
Gene name
Locationscaffold_02:2913012..2914514
Strand-
Gene length (bp)1502
Transcript length (bp)903
Coding sequence length (bp)903
Protein length (aa) 301

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R4E1|TIP_RAT T-cell immunomodulatory protein OS=Rattus norvegicus GN=Itfg1 PE=2 SV=1 28 295 2.0E-14
sp|Q99KW9|TIP_MOUSE T-cell immunomodulatory protein OS=Mus musculus GN=Itfg1 PE=1 SV=2 28 295 5.0E-14
sp|Q8TB96|TIP_HUMAN T-cell immunomodulatory protein OS=Homo sapiens GN=ITFG1 PE=1 SV=1 28 295 2.0E-12
sp|Q95KC8|TIP_MACFA T-cell immunomodulatory protein (Fragment) OS=Macaca fascicularis GN=ITFG1 PE=2 SV=2 117 295 4.0E-12
sp|Q7RRM4|TIP_PLAYO T-cell immunomodulatory protein homolog OS=Plasmodium yoelii yoelii GN=PY00695 PE=3 SV=1 20 295 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R4E1|TIP_RAT T-cell immunomodulatory protein OS=Rattus norvegicus GN=Itfg1 PE=2 SV=1 28 295 2.0E-14
sp|Q99KW9|TIP_MOUSE T-cell immunomodulatory protein OS=Mus musculus GN=Itfg1 PE=1 SV=2 28 295 5.0E-14
sp|Q8TB96|TIP_HUMAN T-cell immunomodulatory protein OS=Homo sapiens GN=ITFG1 PE=1 SV=1 28 295 2.0E-12
sp|Q95KC8|TIP_MACFA T-cell immunomodulatory protein (Fragment) OS=Macaca fascicularis GN=ITFG1 PE=2 SV=2 117 295 4.0E-12
sp|Q7RRM4|TIP_PLAYO T-cell immunomodulatory protein homolog OS=Plasmodium yoelii yoelii GN=PY00695 PE=3 SV=1 20 295 2.0E-11
sp|Q8I3H7|TIP_PLAF7 T-cell immunomodulatory protein homolog OS=Plasmodium falciparum (isolate 3D7) GN=PFE1445c PE=3 SV=1 20 295 1.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 26 0.998947

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1974
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|062860
Agaricus bisporus var bisporus H39 AgabiH39|270400 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|062860
Rhodonia placenta FPRL280 RhoplFPRL280|3_77

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|270400
MVIAWLMSSSVFVLAMQGSLPSGTQSISFADIDRDGTMDMIFTTCKSVSSSGVGSDCYINIAYNQQLPLCSYTTD
SGMKNVPDNNAFVHFPVSSLFRDGHKQSLLVWDMSFDPPIPPVSLRLGDANLDGFPDFLAIFASAMIGHRPGGRG
WEVATNSGMKALANVKDARGGTLDILVQRTGLQDESKVLFIQNNFYYDAFFLKAIALNGACDSGWCYSANGSERY
HPFGDIVQRLKLANFLKRPTTRFKHQYSFFGLGRTNNYIENLFVGTTLHAPEHYINMEGVIPNSRVVILPTCGWW
*
Coding >AgabiH39|270400
ATGGTGATTGCTTGGCTGATGTCTTCCTCAGTATTTGTTCTGGCTATGCAAGGAAGCTTACCATCTGGTACACAA
AGTATCTCCTTTGCCGATATCGACAGAGATGGGACGATGGACATGATATTCACGACATGTAAAAGTGTCTCTTCG
AGCGGAGTCGGTTCAGACTGTTACATTAACATTGCATATAACCAACAACTTCCTTTATGTTCCTACACGACCGAC
TCTGGCATGAAGAATGTCCCTGACAACAATGCTTTTGTTCACTTTCCTGTTTCATCCCTTTTCCGTGATGGTCAC
AAGCAATCCCTGCTTGTTTGGGATATGAGCTTTGATCCACCCATTCCCCCGGTTTCATTACGCTTAGGCGATGCC
AATCTGGACGGCTTTCCCGATTTCCTGGCCATCTTTGCCTCAGCAATGATCGGACACCGTCCGGGGGGAAGAGGT
TGGGAGGTTGCTACGAATTCCGGGATGAAGGCTCTAGCAAATGTAAAAGACGCAAGGGGTGGTACACTTGACATC
TTGGTGCAGCGGACTGGATTGCAGGATGAGAGCAAGGTTTTGTTTATTCAGAATAACTTTTACTATGATGCCTTT
TTCTTAAAGGCGATCGCGCTCAATGGTGCCTGTGATAGCGGATGGTGTTATTCTGCTAATGGGTCTGAACGCTAC
CATCCCTTCGGTGACATCGTTCAGCGGCTCAAATTGGCCAACTTCCTCAAACGTCCTACCACGCGCTTCAAACAC
CAGTACTCATTTTTCGGCCTTGGTCGAACAAACAACTACATCGAGAATCTGTTTGTCGGTACAACACTGCATGCA
CCCGAACATTATATCAACATGGAAGGTGTAATACCCAATTCTCGAGTCGTCATTCTACCAACCTGCGGATGGTGG
TGA
Transcript >AgabiH39|270400
ATGGTGATTGCTTGGCTGATGTCTTCCTCAGTATTTGTTCTGGCTATGCAAGGAAGCTTACCATCTGGTACACAA
AGTATCTCCTTTGCCGATATCGACAGAGATGGGACGATGGACATGATATTCACGACATGTAAAAGTGTCTCTTCG
AGCGGAGTCGGTTCAGACTGTTACATTAACATTGCATATAACCAACAACTTCCTTTATGTTCCTACACGACCGAC
TCTGGCATGAAGAATGTCCCTGACAACAATGCTTTTGTTCACTTTCCTGTTTCATCCCTTTTCCGTGATGGTCAC
AAGCAATCCCTGCTTGTTTGGGATATGAGCTTTGATCCACCCATTCCCCCGGTTTCATTACGCTTAGGCGATGCC
AATCTGGACGGCTTTCCCGATTTCCTGGCCATCTTTGCCTCAGCAATGATCGGACACCGTCCGGGGGGAAGAGGT
TGGGAGGTTGCTACGAATTCCGGGATGAAGGCTCTAGCAAATGTAAAAGACGCAAGGGGTGGTACACTTGACATC
TTGGTGCAGCGGACTGGATTGCAGGATGAGAGCAAGGTTTTGTTTATTCAGAATAACTTTTACTATGATGCCTTT
TTCTTAAAGGCGATCGCGCTCAATGGTGCCTGTGATAGCGGATGGTGTTATTCTGCTAATGGGTCTGAACGCTAC
CATCCCTTCGGTGACATCGTTCAGCGGCTCAAATTGGCCAACTTCCTCAAACGTCCTACCACGCGCTTCAAACAC
CAGTACTCATTTTTCGGCCTTGGTCGAACAAACAACTACATCGAGAATCTGTTTGTCGGTACAACACTGCATGCA
CCCGAACATTATATCAACATGGAAGGTGTAATACCCAATTCTCGAGTCGTCATTCTACCAACCTGCGGATGGTGG
TGA
Gene >AgabiH39|270400
ATGGTGATTGCTTGGCTGGTGTGTACTCATGCGCAGGATGTGATATACTGGCTGTAACCAACGCGTGTTAGATGT
CTTCCTCAGTGTTTGTGATGAGGGCCGCGGACAGAAATCGTTTCAGATCTGGCTCAACAAAAAGTCTCAAAGATT
TGTTCTGGCTATGCAAGGAAGCTTACCATCTGGTACACAAAGTATCTCCTTTGCCGATATCGGTAAACTCAAACA
TCGATTTGTTTCATAGATTGTCCACTGACAGCTACACAGACAGAGATGGGACGATGGACATGATATTCACGACAT
GTAAAAGTGTCTCTTCGAGCGGAGTCGGTTCAGACTGTTACATTAACATTGCATATAACCAACAACTTCCTTTAT
GTTCCTACACGACCGACTCTGGCATGAAGAATGTGTAGACCACCGAACGATCTTTGTACCGCCGATGACAACTTT
CAATTCAATCTTCTAGACAGCCCTGACAACAATGTCAGTTCCCGACTTCAATGTCCTTTCTACGCACTTATCCAG
TTATATAGGCTTTTGTTCACTTTCCTGTTTCATCCCTTTTCCGTGATGGTCACAAGCAATCCCTGCTTGTTTGGG
ATATGAGCTTTGATCCACCCATTCCCCCGGTTTCATTACGCTTAGGCGATGCCAATCTGGACGGCTTTCCCGATT
TCCTGGCCATCTTTGCCTCAGCAATGATCGGACACCGTATCTCGCCTATTCCAAGCATTGTGCTTCTGGAGTTGT
AGGGTGTGACAGTAAAGGTCCGGGGGGAAGAGGTTGGGAGGTTGCTACGAATTCCGGGATGAAGGCTCTAGCAAA
TGTAAAAGACGCAAGGGGTGTGGATAAACAATTTTCTGCACGATGACAAGAGACTCAATGATATGTACAGGGTAC
ACTTGACATCTTGGTGCAGCGGACTGGATTGCAGGATGAGAGCAAGGTTTTGTTTATTCAGAATAACTTTTACTA
TGATGCCTTTTTCTTAAAGGCGATCGGTGCGTTTCTCTATGAGCCGGGTCTACGAAAAGCTGATGAATCAATATC
TTTCCAGCGCTCAATGGTGCCTGTGATAGCGGATGGTGTTATTCTGCTAATGGGTCTGAACGCTACCATGTAAAA
CCTTGCCATTGACTGATAGTCGAGTCCGTACTGATGATTCATCGTAGCCCTTCGGTGTCAGCTATTCAGGAGCAA
CGTACAAGTATACAGTATTCAATACATTAGGACATCGTTCAGCGGCTCAAAGTTTGTCTTTGTCACCTCTTATCC
TCTCTTGCCGCTAACACATGTTGAACCAATAGTTGGCCAACTTCCTCAAACGTCCTACCACGCGCTTCAAACACC
AGTACTCATTTTTCGGCCTTGGTCGAACAAACAACTACATCGAGAATCTGTTTGTCGGTACAACACTGCATGCAC
CCGAACATTATATCAACATGGAAGGTGTAATACCCAATTCTCGAGTCGTCATTCTACCAACCTGCGGATGGTGGT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail