Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|240900
Gene name
Locationscaffold_02:399545..402688
Strand-
Gene length (bp)3143
Transcript length (bp)2619
Coding sequence length (bp)2619
Protein length (aa) 873

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06588 Muskelin_N Muskelin N-terminus 6.1E-58 10 204
PF13418 Kelch_4 Galactose oxidase, central domain 1.8E-07 262 312
PF13418 Kelch_4 Galactose oxidase, central domain 5.3E-09 481 524
PF13415 Kelch_3 Galactose oxidase, central domain 7.6E-07 275 325
PF13854 Kelch_5 Kelch motif 7.5E-07 259 298
PF13854 Kelch_5 Kelch motif 1.5E-05 480 518
PF13964 Kelch_6 Kelch motif 5.0E-06 481 524
PF01344 Kelch_1 Kelch motif 1.5E-06 272 305

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99PV3|MKLN1_RAT Muskelin OS=Rattus norvegicus GN=Mkln1 PE=1 SV=1 5 728 2.0E-139
sp|O89050|MKLN1_MOUSE Muskelin OS=Mus musculus GN=Mkln1 PE=1 SV=1 5 728 2.0E-139
sp|Q5RB35|MKLN1_PONAB Muskelin OS=Pongo abelii GN=MKLN1 PE=2 SV=1 5 728 5.0E-139
sp|Q9UL63|MKLN1_HUMAN Muskelin OS=Homo sapiens GN=MKLN1 PE=1 SV=2 5 728 1.0E-138
sp|O13730|MDE6_SCHPO Mei4-dependent protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde6 PE=4 SV=2 10 707 7.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99PV3|MKLN1_RAT Muskelin OS=Rattus norvegicus GN=Mkln1 PE=1 SV=1 5 728 2.0E-139
sp|O89050|MKLN1_MOUSE Muskelin OS=Mus musculus GN=Mkln1 PE=1 SV=1 5 728 2.0E-139
sp|Q5RB35|MKLN1_PONAB Muskelin OS=Pongo abelii GN=MKLN1 PE=2 SV=1 5 728 5.0E-139
sp|Q9UL63|MKLN1_HUMAN Muskelin OS=Homo sapiens GN=MKLN1 PE=1 SV=2 5 728 1.0E-138
sp|O13730|MDE6_SCHPO Mei4-dependent protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde6 PE=4 SV=2 10 707 7.0E-70
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 433 598 2.0E-07
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 431 624 4.0E-07
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 420 515 4.0E-07
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 431 636 1.0E-06
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 405 598 1.0E-06
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 423 599 6.0E-06
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 429 563 8.0E-06
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 417 639 8.0E-06
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 431 516 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup2853
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|240900 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|040350
Rhodonia placenta FPRL280 RhoplFPRL280|82_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|240900
MISPPPSVPLSYTVVQSTPHSGKYGPEHILLDKPSDQASRWSGAYQGNTAKQWILLKLDQMSVLKTIAFGKFSKP
HPCNMKDFKVYVGITEENLVQVLHGGLKNDTTAEAFPIRHVNNAHVCFPTRYVKIVPLSAHGQNFHTSIWHVALN
GISDKKYVDHIYRIHEEHRESTVLRHVLKHLRQRRLLTPYQDILSRAFTNVEHPLITQLHATLVLGGAFKDAEKH
LQTLSSSGLFSSYLQSSHPYAVWDRISQTGDDEIPSPRSGHAMCIDAVNEVIYLHGGYNGENCLDDFWAYNIKDE
RWHKLMDSTHSKNGPSTRSCHKMTLDCKTGIIYVLGRLTDVDAARAPLSRQGPTNTTATGPQSSHRSQSHLPFPS
LPPLPTSDPPSNTYCSDFYLYHTRGPEEGVWKYISFDTASSGGPPLVFDHQMVVDSEAQALYVFGGRVLDGDWDT
YKYAGLYAYNLKSSRWKLLQPADNSPATIPPRYGHSMVLDSNTRTLYIFGGQKEEKYLSDMYTYNLSTSTVTELF
SNFTLEGGPTACFTQRAVIDTDLKEIYVFCGLVTDAFGMTGYLPGDLYNWVYRYNTRPGTWTHIRPEGDRPNPKP
RSVPKKVEEPRPRYAHDVVYHPRSKRLYLFGGNANLRGPKDEDAMVDDAFDGIQKMSDFWKMEVRRPGSEEIIRK
ATYHIRRQQFREMCEERTPSEALNFLKTQVSPVVNHDDQKETEDYRSLTTFLLAPKASPPLVIPPVFPKSASSKD
NPSPLSEKSSGSIKDDWITGSRGTTPSDGTWSSELMEVSDDDTEMIHRVSHPRLSADLLRSVEDPLEKQKGGKGV
AMSAERYAQRTEVFECLLDFVSEWDKEPSGSLLDFVTRNDSREDDNF*
Coding >AgabiH39|240900
ATGATTTCACCGCCGCCTTCTGTGCCGTTGAGCTACACTGTTGTGCAATCAACACCGCATAGCGGAAAGTATGGG
CCTGAACATATACTCCTGGACAAGCCTTCAGACCAAGCTAGCAGATGGAGCGGCGCGTACCAAGGGAACACTGCG
AAACAATGGATTTTGCTCAAGCTAGACCAGATGTCTGTTCTAAAAACGATAGCTTTTGGAAAGTTTTCGAAACCA
CATCCATGTAACATGAAAGACTTCAAGGTATACGTCGGAATTACAGAAGAAAACCTAGTCCAAGTGTTACATGGT
GGCCTCAAGAATGACACGACTGCCGAAGCATTTCCCATCCGCCATGTCAACAATGCTCACGTATGTTTCCCAACC
CGCTACGTCAAGATTGTCCCTCTATCTGCGCATGGCCAGAATTTCCATACTTCAATATGGCACGTTGCATTGAAC
GGAATCTCGGATAAGAAATATGTTGATCACATATACCGCATACATGAGGAGCACCGAGAAAGCACTGTTCTTCGT
CACGTTCTCAAGCACTTGAGACAACGCCGTCTCCTTACTCCATATCAAGATATCCTCTCGCGAGCTTTCACAAAC
GTTGAACACCCTCTAATCACCCAATTACACGCCACTCTGGTTCTTGGAGGTGCATTTAAAGATGCAGAGAAGCAC
CTTCAAACACTTTCTTCCTCTGGCCTCTTCTCATCGTATCTCCAATCTTCACATCCTTATGCAGTATGGGACAGG
ATATCGCAAACAGGCGATGATGAAATACCATCCCCAAGGAGCGGTCACGCCATGTGTATAGACGCTGTTAATGAA
GTTATCTACCTCCACGGAGGCTACAATGGCGAGAATTGTTTGGACGATTTTTGGGCGTATAACATCAAAGACGAG
AGGTGGCACAAGCTTATGGATTCAACGCACAGTAAAAATGGACCAAGTACTAGAAGCTGTCATAAGATGACTTTG
GACTGCAAGACTGGCATTATCTATGTTCTCGGCAGATTAACAGATGTTGATGCTGCCAGGGCGCCTCTTTCTCGC
CAGGGCCCCACAAACACGACCGCCACAGGACCGCAGAGTTCTCATAGATCCCAATCTCACTTACCTTTCCCTTCC
CTACCTCCCCTACCGACGAGCGATCCACCTTCCAACACCTATTGTTCTGATTTCTACCTCTATCACACAAGAGGG
CCAGAAGAAGGAGTATGGAAGTACATCTCCTTCGATACAGCCAGCAGTGGAGGCCCTCCCCTAGTCTTTGATCAC
CAGATGGTTGTCGATAGCGAAGCGCAAGCTCTCTACGTCTTCGGTGGGCGAGTACTTGATGGTGACTGGGATACT
TACAAATATGCTGGTCTATATGCGTATAACCTTAAGTCGTCACGGTGGAAATTACTTCAGCCCGCAGATAACTCG
CCTGCTACGATACCCCCACGCTACGGTCACTCAATGGTTTTGGACTCAAATACGAGAACTTTATATATCTTCGGG
GGCCAAAAAGAGGAGAAATATCTTTCGGACATGTACACGTACAATCTGAGTACGAGTACCGTCACAGAGCTATTT
TCGAACTTCACGCTAGAAGGTGGACCAACTGCGTGCTTTACTCAAAGAGCCGTGATTGATACCGACTTGAAGGAG
ATCTACGTATTCTGCGGTCTCGTCACGGATGCTTTCGGTATGACGGGATATCTTCCAGGGGACCTATACAACTGG
GTGTATAGATATAATACAAGGCCAGGCACTTGGACCCATATTCGACCTGAAGGCGATCGACCAAATCCGAAACCC
CGTTCGGTGCCAAAGAAAGTCGAGGAACCACGTCCGAGATATGCGCACGATGTCGTATATCACCCCAGATCTAAG
CGACTTTACCTGTTCGGTGGCAATGCGAATCTCAGGGGTCCAAAGGACGAGGATGCGATGGTAGACGATGCGTTT
GATGGAATTCAGAAGATGAGCGATTTCTGGAAAATGGAAGTGCGCAGACCCGGGTCTGAGGAGATAATCAGAAAA
GCTACATATCACATTCGGCGTCAACAATTCCGTGAAATGTGCGAGGAAAGAACACCCTCTGAGGCACTCAATTTT
TTGAAAACCCAGGTCTCTCCTGTTGTCAACCATGATGATCAAAAGGAAACAGAAGACTATCGGTCTCTAACGACG
TTCCTCCTCGCACCAAAAGCATCTCCTCCACTCGTCATACCTCCTGTCTTTCCCAAATCTGCGTCATCCAAGGAT
AACCCATCACCATTGTCGGAAAAAAGCTCAGGAAGTATCAAAGACGACTGGATAACGGGGTCAAGGGGAACTACC
CCAAGTGATGGAACATGGTCAAGCGAGTTGATGGAAGTTTCGGATGATGACACTGAAATGATACATCGAGTCTCT
CATCCTAGATTGAGCGCGGATTTGTTGAGATCTGTTGAAGATCCGCTGGAGAAGCAGAAAGGTGGTAAAGGCGTG
GCTATGTCTGCGGAGAGATATGCACAGAGGACGGAAGTGTTTGAGTGTTTGTTGGATTTTGTGAGTGAGTGGGAT
AAGGAGCCGTCTGGAAGTTTGTTGGATTTTGTGACGAGGAATGACTCTAGAGAGGATGATAACTTTTAG
Transcript >AgabiH39|240900
ATGATTTCACCGCCGCCTTCTGTGCCGTTGAGCTACACTGTTGTGCAATCAACACCGCATAGCGGAAAGTATGGG
CCTGAACATATACTCCTGGACAAGCCTTCAGACCAAGCTAGCAGATGGAGCGGCGCGTACCAAGGGAACACTGCG
AAACAATGGATTTTGCTCAAGCTAGACCAGATGTCTGTTCTAAAAACGATAGCTTTTGGAAAGTTTTCGAAACCA
CATCCATGTAACATGAAAGACTTCAAGGTATACGTCGGAATTACAGAAGAAAACCTAGTCCAAGTGTTACATGGT
GGCCTCAAGAATGACACGACTGCCGAAGCATTTCCCATCCGCCATGTCAACAATGCTCACGTATGTTTCCCAACC
CGCTACGTCAAGATTGTCCCTCTATCTGCGCATGGCCAGAATTTCCATACTTCAATATGGCACGTTGCATTGAAC
GGAATCTCGGATAAGAAATATGTTGATCACATATACCGCATACATGAGGAGCACCGAGAAAGCACTGTTCTTCGT
CACGTTCTCAAGCACTTGAGACAACGCCGTCTCCTTACTCCATATCAAGATATCCTCTCGCGAGCTTTCACAAAC
GTTGAACACCCTCTAATCACCCAATTACACGCCACTCTGGTTCTTGGAGGTGCATTTAAAGATGCAGAGAAGCAC
CTTCAAACACTTTCTTCCTCTGGCCTCTTCTCATCGTATCTCCAATCTTCACATCCTTATGCAGTATGGGACAGG
ATATCGCAAACAGGCGATGATGAAATACCATCCCCAAGGAGCGGTCACGCCATGTGTATAGACGCTGTTAATGAA
GTTATCTACCTCCACGGAGGCTACAATGGCGAGAATTGTTTGGACGATTTTTGGGCGTATAACATCAAAGACGAG
AGGTGGCACAAGCTTATGGATTCAACGCACAGTAAAAATGGACCAAGTACTAGAAGCTGTCATAAGATGACTTTG
GACTGCAAGACTGGCATTATCTATGTTCTCGGCAGATTAACAGATGTTGATGCTGCCAGGGCGCCTCTTTCTCGC
CAGGGCCCCACAAACACGACCGCCACAGGACCGCAGAGTTCTCATAGATCCCAATCTCACTTACCTTTCCCTTCC
CTACCTCCCCTACCGACGAGCGATCCACCTTCCAACACCTATTGTTCTGATTTCTACCTCTATCACACAAGAGGG
CCAGAAGAAGGAGTATGGAAGTACATCTCCTTCGATACAGCCAGCAGTGGAGGCCCTCCCCTAGTCTTTGATCAC
CAGATGGTTGTCGATAGCGAAGCGCAAGCTCTCTACGTCTTCGGTGGGCGAGTACTTGATGGTGACTGGGATACT
TACAAATATGCTGGTCTATATGCGTATAACCTTAAGTCGTCACGGTGGAAATTACTTCAGCCCGCAGATAACTCG
CCTGCTACGATACCCCCACGCTACGGTCACTCAATGGTTTTGGACTCAAATACGAGAACTTTATATATCTTCGGG
GGCCAAAAAGAGGAGAAATATCTTTCGGACATGTACACGTACAATCTGAGTACGAGTACCGTCACAGAGCTATTT
TCGAACTTCACGCTAGAAGGTGGACCAACTGCGTGCTTTACTCAAAGAGCCGTGATTGATACCGACTTGAAGGAG
ATCTACGTATTCTGCGGTCTCGTCACGGATGCTTTCGGTATGACGGGATATCTTCCAGGGGACCTATACAACTGG
GTGTATAGATATAATACAAGGCCAGGCACTTGGACCCATATTCGACCTGAAGGCGATCGACCAAATCCGAAACCC
CGTTCGGTGCCAAAGAAAGTCGAGGAACCACGTCCGAGATATGCGCACGATGTCGTATATCACCCCAGATCTAAG
CGACTTTACCTGTTCGGTGGCAATGCGAATCTCAGGGGTCCAAAGGACGAGGATGCGATGGTAGACGATGCGTTT
GATGGAATTCAGAAGATGAGCGATTTCTGGAAAATGGAAGTGCGCAGACCCGGGTCTGAGGAGATAATCAGAAAA
GCTACATATCACATTCGGCGTCAACAATTCCGTGAAATGTGCGAGGAAAGAACACCCTCTGAGGCACTCAATTTT
TTGAAAACCCAGGTCTCTCCTGTTGTCAACCATGATGATCAAAAGGAAACAGAAGACTATCGGTCTCTAACGACG
TTCCTCCTCGCACCAAAAGCATCTCCTCCACTCGTCATACCTCCTGTCTTTCCCAAATCTGCGTCATCCAAGGAT
AACCCATCACCATTGTCGGAAAAAAGCTCAGGAAGTATCAAAGACGACTGGATAACGGGGTCAAGGGGAACTACC
CCAAGTGATGGAACATGGTCAAGCGAGTTGATGGAAGTTTCGGATGATGACACTGAAATGATACATCGAGTCTCT
CATCCTAGATTGAGCGCGGATTTGTTGAGATCTGTTGAAGATCCGCTGGAGAAGCAGAAAGGTGGTAAAGGCGTG
GCTATGTCTGCGGAGAGATATGCACAGAGGACGGAAGTGTTTGAGTGTTTGTTGGATTTTGTGAGTGAGTGGGAT
AAGGAGCCGTCTGGAAGTTTGTTGGATTTTGTGACGAGGAATGACTCTAGAGAGGATGATAACTTTTAG
Gene >AgabiH39|240900
ATGATTTCACCGCCGCCTTCTGTGCCGTTGAGCTACACTGTTGTGCAATCAACACCGCATAGCGGAAAGTATGGG
CCTGAACATATACTCCTGGACAAGCCTTCAGACCAAGCTAGCAGATGGAGCGGCGCGTACCAAGGGAACACTGCG
AAACAATGGATTTTGCTCAAGCTAGACCAGATGTCTGTTCTAAGTGTGTAGGCTTTCGTGACGCCCACCGCTTAC
TGAATCTAATTGTCGTGCAATCATCAGAAACGATAGCTTTTGGAAAGGCAAGTATTCTTTCAGTCGCAAGGCTTG
ATCCGCTGAAGAGTATCTTCAGTTTTCGAAACGTACGCTCTTCATGCCCAGCCCCAAAATCCGTTTCATCTGACT
CGTGGTTCAAGCACATCCATGTAACATGAAAGACTTCAAGGTATACGTCGGAATTACAGAAGAAAACCTAGTCCA
AGTGTTACATGGTGGCCTCAAGAATGACACGACTGCCGAAGCATTTCCCATCCGCCATGTCAACAATGCTCACGT
ATGTTTCCCAACCCGCTACGTCAAGATTGTCCCTCTATCGTGCGTTGATGGTCTTCGCGTTGCAGTTGTTGTATA
ACGATATTCTGGTCCCACAGTGCGCATGGCCAGAATTTCCATACTTCAATATGGCACGTTGCATTGAACGGAATC
TCGGATAAGAAATATGTTGATCACATATACCGCATACATGAGGAGGTGCGAGGTTTGCCACCGCGCCATGGCTCT
CATTCACCTGAATCTCCAGCACCGAGAAAGCACTGTTCTTCGTCACGTTCTCAAGCACTTGAGACAACGCCGTCT
CCTTACTCCATATCAAGATATCCTCTCGCGAGCTTTCACAAACGTTGAACACCCTCTAATCACCCAATTACACGC
CACTCTGGTTCTTGGAGGTGCATTTAAAGATGCAGAGAAGCACCTTCAAACACTTTCTTCCTCTGGCCTCTTCTC
ATCGTATCTCCAATCTTCACATCCTTATGCAGTATGGGACAGGATATCGCAAACAGGCGATGATGAAATACCATC
CCCAAGGAGCGGTCACGCCATGTGTATAGACGCTGTTAATGAAGTTATCTACCTCCACGGAGGCTACAATGGCGA
GAATTGTTTGGACGATTTTTGGGCGTATAACATCAAAGACGAGAGGTGGCACAAGCTTATGGATTCAACGCACAG
TAAAAATGGACCAAGTACTAGAAGCTGTCATAAGATGACTTTGGACTGCAAGACTGGCATTATCTATGTTCTCGG
CAGATTAACAGATGTTGATGCTGCCAGGGCGCCTCTTTCTCGCCAGGGCCCCACAAACACGACCGCCACAGGACC
GCAGAGTTCTCATAGATCCCAATCTCACTTACCTTTCCCTTCCCTACCTCCCCTACCGACGAGCGATCCACCTTC
CAACACCTATTGTTCTGATTTCTACCTCTATCACACAAGAGGGCCAGAAGAAGGAGTATGGAAGTACATCTCCTT
CGATACAGCCGTGAGTGTATACCTCCCATCTCATATGTTGCCATTCCTGAAATTCTTGTAGAGCAGTGGAGGCCC
TCCCCTAGTCTTTGATCACCAGATGGTTGTCGATAGCGAAGCGCAAGCTCTCTACGTCTTCGGTGGGCGAGTACT
TGATGGTGACTGGGATACTTACAAATATGCTGGTCTATATGCGTATAACCTTAAGTCGTCACGGTGGAAATTACT
TCAGTATGTCTATAAGCTTCTTCTCAAGGCATTTTACTGATGAGAGTAGGCCCGCAGATAACTCGCCTGCTACGA
TACCCCCACGCTACGGTCACTCAATGGTTTTGGACTCAAATACGAGAACTTTATATATCTTCGGGGGCCAAAAAG
AGGAGAAATATCTTTCGGACATGTACACGTACAATCTGAGTACGAGTACCGTCACAGAGCTATTTTCGAACTTCA
CGCTAGAAGGTGGACCAACTGCGTGCTTTACTCAAAGAGCCGTGATTGATACCGACTTGAAGGAGATCTACGTGT
AAGTCGTTCTCTACTTTCCATGATTTTTTAAACTAAGGGCTTTGGTTTAGATTCTGCGGTCTCGTCACGGATGCT
TTCGGTATGACGGGATATCTTCCAGGGGACCTATACAACTGGGTGTATAGATATAATACAAGGCCAGGCACTTGG
ACCCATATTCGACCTGAAGGCGATCGACCAAATCCGAAACCCCGTTCGGTGCCAAAGAAAGTCGAGGAACCACGT
CCGAGATATGCGCACGATGTCGTATATCACCCCAGATCTAAGCGACTTTACCTGTTCGGTGGCAATGCGAATCTC
AGGGGTCCAAAGGACGAGGATGCGATGGTAGACGATGCGTTTGATGGAATTCAGAAGATGAGCGATTTCTGGAAA
ATGGAAGTGCGCAGGTGGGTGGTATAATGTATTTTTGGGCAGAAGACAAACTCAAAGGTTTGATAGACCCGGGTC
TGAGGAGATAATCAGAAAAGCTACATATCACATTCGGCGTCAACAGTAGGCATTTCTTTCATCTATTGATGTATA
TGCCGGGCGTTCATGGTCAACCTAGATTCCGTGAAATGTGCGAGGAAAGAACACCCTCTGAGGCACTCAATTTTT
TGAAAACCCAGGTCTCTCCTGTTGTCAACCATGATGATCAAAAGGAAACAGAAGACTATCGGTCTCTAACGACGT
TCCTCCTCGCACCAAAAGCATCTCCTCCACTCGTCATACCTCCTGTCTTTCCCAAATCTGCGTCATCCAAGGATA
ACCCATCACCATTGTCGGAAAAAAGCTCAGGAAGTATCAAAGACGACTGGATAACGGGGTCAAGGGGAACTACCC
CAAGTGATGGAACATGGTCAAGCGAGTTGATGGAAGTTTCGGATGATGACACTGAAATGATACATCGAGTCTCTC
ATCCTAGATTGAGCGCGGATTTGTTGAGATCTGTTGAAGATCCGCTGGAGAAGCAGAAAGGTGGTAAAGGCGTGG
CTATGTCTGCGGAGAGATATGCACAGAGGACGGAAGTGTTTGAGTGTTTGTTGGATTTTGTGAGTGAGTGGGATA
AGGAGCCGTCTGGAAGTTTGTTGGATTTTGTGACGAGGAATGACTCTAGAGAGGATGATAACTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail