Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|238500
Gene name
Locationscaffold_02:120341..121990
Strand-
Gene length (bp)1649
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 1.1E-06 16 58
PF00646 F-box F-box domain 2.1E-06 15 55

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1266
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|038860
Agaricus bisporus var bisporus H39 AgabiH39|038870
Agaricus bisporus var bisporus H39 AgabiH39|038890
Agaricus bisporus var bisporus H39 AgabiH39|038930
Agaricus bisporus var bisporus H39 AgabiH39|039040
Agaricus bisporus var bisporus H39 AgabiH39|238500 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|295900
Agaricus bisporus var bisporus H97 AgabiH97|038930
Agaricus bisporus var bisporus H97 AgabiH97|038920
Agaricus bisporus var bisporus H97 AgabiH97|038910
Agaricus bisporus var bisporus H97 AgabiH97|038900
Agaricus bisporus var bisporus H97 AgabiH97|038860
Agaricus bisporus var bisporus H97 AgabiH97|038870
Agaricus bisporus var bisporus H97 AgabiH97|039040
Agaricus bisporus var bisporus H97 AgabiH97|038850
Agaricus bisporus var bisporus H97 AgabiH97|038890
Agaricus bisporus var bisporus H97 AgabiH97|063380

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|238500
MSTTRQTDEPSKIGFSSLPSEIVSEIFKELDWRDLLNARQTCTLLYNASRSREIWDNLIRIHAAAAHGPPTIFDK
PICMYNAAKLEERFLRWMKTESTWLNEIPLNEKYIPDSSHEFLYSHLLRGGRWLICSDFGGEVLYCDLESPETSF
VPLIPYPFSSRRKSMTLMAVEEDPESEILSFKIALVHMLFADYVKGPHGEPEVTGDSRIDVWSGHVILDETGQGR
GLEVGLLASIPISLYLGQPLFGVSLRGPLVAFTVEWHWFGTTIYSCDAIIVDWSSWKSQGQSFRRKTVNYLTSFA
GDGRKVEVMLLPEDRVLTVPSSRLRIYDHSLIPWSSEERPECVDMSVSQQHSYSVTVPGTSIQHPCGFSKLFPLL
DNEYRVVFNTIVGIRGLIMRYTEAGNFQATALELLDWSEKMDKSIREFRSHFSYNCGVARSKSGHLLRARFSWPD
EEGSVETGMTPILGEPNETPLIMNVDIAAGRLAWITAESGRVVMLDFQ*
Coding >AgabiH39|238500
ATGTCAACAACCCGCCAAACGGACGAACCGTCAAAGATTGGGTTCAGTTCGCTACCATCTGAAATCGTCTCGGAA
ATATTCAAAGAACTAGATTGGAGAGATTTACTGAACGCACGCCAGACTTGTACACTCCTTTATAACGCGTCAAGA
TCTAGAGAGATATGGGACAACTTGATTAGAATCCATGCCGCCGCCGCTCATGGGCCTCCGACGATATTCGACAAA
CCTATATGCATGTACAACGCTGCCAAACTCGAAGAGCGATTTCTCCGTTGGATGAAAACCGAGTCCACCTGGCTC
AACGAAATCCCTTTGAATGAAAAATACATTCCGGATTCTTCACACGAATTCCTGTACTCTCATCTCCTTCGAGGA
GGCCGATGGCTCATCTGCTCCGACTTTGGAGGCGAGGTGCTCTACTGCGATCTCGAATCACCCGAGACTAGCTTC
GTCCCTCTGATCCCGTATCCGTTCTCGTCCCGGCGTAAATCTATGACTCTGATGGCTGTTGAAGAGGATCCCGAG
AGTGAAATCTTGTCTTTCAAAATCGCCCTGGTCCATATGTTGTTTGCCGACTATGTTAAAGGGCCACATGGAGAA
CCTGAGGTGACTGGGGATTCGCGCATTGATGTATGGTCGGGTCATGTTATTTTGGATGAGACCGGCCAGGGAAGG
GGCTTAGAAGTTGGGCTGCTTGCGTCCATTCCTATATCTTTGTATCTTGGCCAACCTCTGTTCGGCGTGTCTCTA
CGTGGTCCCCTTGTCGCCTTCACCGTAGAATGGCATTGGTTCGGCACGACAATTTATTCATGTGATGCGATTATT
GTCGACTGGAGCTCGTGGAAAAGCCAGGGTCAATCTTTCAGACGGAAAACAGTCAATTATCTGACCAGTTTCGCT
GGAGATGGTCGAAAGGTCGAAGTGATGTTACTTCCCGAAGACCGAGTGCTTACGGTACCCTCCTCAAGGCTTCGC
ATTTACGACCATTCATTAATTCCATGGTCTTCAGAGGAGAGGCCTGAGTGCGTGGATATGTCTGTATCCCAACAA
CATTCATATAGTGTCACTGTGCCCGGAACTTCCATTCAACATCCTTGTGGCTTCTCGAAACTATTCCCTCTCCTG
GATAATGAGTATCGAGTGGTATTCAACACCATAGTCGGGATAAGAGGACTCATCATGCGTTATACAGAAGCGGGC
AATTTTCAGGCAACAGCACTGGAGCTCCTCGACTGGAGCGAAAAGATGGATAAAAGTATTAGGGAATTTCGATCC
CATTTCTCATATAATTGCGGGGTTGCCCGCTCTAAATCGGGTCACCTTTTACGTGCTCGTTTTTCCTGGCCTGAC
GAGGAAGGCTCTGTCGAAACAGGAATGACTCCTATCTTAGGGGAACCGAATGAGACACCTTTGATTATGAACGTG
GACATCGCAGCTGGAAGGCTGGCATGGATAACGGCTGAGAGCGGCCGAGTGGTTATGCTGGATTTTCAGTGA
Transcript >AgabiH39|238500
ATGTCAACAACCCGCCAAACGGACGAACCGTCAAAGATTGGGTTCAGTTCGCTACCATCTGAAATCGTCTCGGAA
ATATTCAAAGAACTAGATTGGAGAGATTTACTGAACGCACGCCAGACTTGTACACTCCTTTATAACGCGTCAAGA
TCTAGAGAGATATGGGACAACTTGATTAGAATCCATGCCGCCGCCGCTCATGGGCCTCCGACGATATTCGACAAA
CCTATATGCATGTACAACGCTGCCAAACTCGAAGAGCGATTTCTCCGTTGGATGAAAACCGAGTCCACCTGGCTC
AACGAAATCCCTTTGAATGAAAAATACATTCCGGATTCTTCACACGAATTCCTGTACTCTCATCTCCTTCGAGGA
GGCCGATGGCTCATCTGCTCCGACTTTGGAGGCGAGGTGCTCTACTGCGATCTCGAATCACCCGAGACTAGCTTC
GTCCCTCTGATCCCGTATCCGTTCTCGTCCCGGCGTAAATCTATGACTCTGATGGCTGTTGAAGAGGATCCCGAG
AGTGAAATCTTGTCTTTCAAAATCGCCCTGGTCCATATGTTGTTTGCCGACTATGTTAAAGGGCCACATGGAGAA
CCTGAGGTGACTGGGGATTCGCGCATTGATGTATGGTCGGGTCATGTTATTTTGGATGAGACCGGCCAGGGAAGG
GGCTTAGAAGTTGGGCTGCTTGCGTCCATTCCTATATCTTTGTATCTTGGCCAACCTCTGTTCGGCGTGTCTCTA
CGTGGTCCCCTTGTCGCCTTCACCGTAGAATGGCATTGGTTCGGCACGACAATTTATTCATGTGATGCGATTATT
GTCGACTGGAGCTCGTGGAAAAGCCAGGGTCAATCTTTCAGACGGAAAACAGTCAATTATCTGACCAGTTTCGCT
GGAGATGGTCGAAAGGTCGAAGTGATGTTACTTCCCGAAGACCGAGTGCTTACGGTACCCTCCTCAAGGCTTCGC
ATTTACGACCATTCATTAATTCCATGGTCTTCAGAGGAGAGGCCTGAGTGCGTGGATATGTCTGTATCCCAACAA
CATTCATATAGTGTCACTGTGCCCGGAACTTCCATTCAACATCCTTGTGGCTTCTCGAAACTATTCCCTCTCCTG
GATAATGAGTATCGAGTGGTATTCAACACCATAGTCGGGATAAGAGGACTCATCATGCGTTATACAGAAGCGGGC
AATTTTCAGGCAACAGCACTGGAGCTCCTCGACTGGAGCGAAAAGATGGATAAAAGTATTAGGGAATTTCGATCC
CATTTCTCATATAATTGCGGGGTTGCCCGCTCTAAATCGGGTCACCTTTTACGTGCTCGTTTTTCCTGGCCTGAC
GAGGAAGGCTCTGTCGAAACAGGAATGACTCCTATCTTAGGGGAACCGAATGAGACACCTTTGATTATGAACGTG
GACATCGCAGCTGGAAGGCTGGCATGGATAACGGCTGAGAGCGGCCGAGTGGTTATGCTGGATTTTCAGTGA
Gene >AgabiH39|238500
ATGTCAACAACCCGCCAAACGGACGTGAGTCTTTTCGTGAGGCGAAGATCGACTCACCGGAGCAGTATACTAGGA
ACCGTCAAAGATTGGGTTCAGTTCGCTACCATCTGAAATCGTCTCGGAAATATTCAAAGAACTAGATTGGAGAGA
TTTACTGAACGCACGCCAGGTGAGTGTGCATTCATTTGTTCTTTATACCGCAATCTAATCCCGTACGTAGACTTG
TACACTCCTTTATAACGCGTCAAGATCTAGAGAGATATGGGACAACTTGATTAGAATCCATGCCGCCGCCGCTCA
TGGGCCTCCGACGATATTCGACAAACCTATATGCATGTACAACGCTGCCAAACTCGAAGAGCGATTTCTCCGTTG
GATGAAAACCGAGTCCACCTGGCTCAACGAAATCCCTTTGAATGAAAAATACATTCCGGATTCTTCACACGAATT
CCTGTACTCTCATCTCCTTCGAGGAGGCCGATGGCTCATCTGCTCCGACTTTGGAGGCGAGGTGCTCTACTGCGA
TCTCGAATCACCCGAGACTAGCTTCGTCCCTCTGATCCCGTATCCGTTCTCGTCCCGGCGTAAATCTATGACTCT
GATGGCTGTTGAAGAGGATCCCGAGAGTGAAATCTTGTCTTTCAAAATCGCCCTGGTCCATATGTTGTTTGCCGA
CTATGTTAAAGGGCCACATGGAGAACCTGAGGTGACTGGGGATTCGCGCATTGATGTATGGTCGGGTCATGTTAT
TTTGGATGAGACCGGCCAGGGAAGGGGCTTAGAAGTTGGGCTGCTTGCGTCCATTCCTATATCTTTGTATCTTGG
CCAACCTCTGTTCGGCGTGTCTCTACGTGGTCCCCTTGTCGCCTTCACCGTAGAATGGCATTGGTTCGGCACGAC
AATTTATTCATGTGATGCGATTATTGTCGACTGGAGCTCGTGGAAAAGCCAGGGTCAATCTTTCAGACGGAAAAC
AGTCAATTATCTGACCAGTTTCGCTGGAGATGGTCGAAAGGTAAGTTGTTTCCTGCTAGTTCCAGAACATAAGAT
TGACCTGCCTACTTTAGGTCGAAGTGATGTTACTTCCCGAAGACCGAGTGCTTACGGTACCCTCCTCAAGGCTTC
GCATTTACGACCATTCATTAATTCCATGGTCTTCAGAGGAGAGGCCTGAGTGCGTGGATATGTCTGTATCCCAAC
AACATTCATATAGTGTCACTGTGCCCGGAACTTCCATTCAACATCCTTGTGGCTTCTCGAAACTATTCCCTCTCC
TGGATAATGAGTATCGAGTGGTATTCAACACCATAGTCGGGATAAGAGGACTCATCATGCGTTATACAGAAGCGG
GCAATTTTCAGGCAACAGCACTGGAGCTCCTCGACTGGAGCGAAAAGATGGATAAAAGTATTAGGGAATTTCGAT
CCCATTTCTCATATAATTGCGGGGTTGCCCGCTCTAAATCGGGTCACCTTTTACGTGCTCGTTTTTCCTGGCCTG
ACGAGGAAGGCTCTGTCGAAACAGGAATGACTCCTATCTTAGGGGAACCGAATGAGACACCTTTGATTATGAACG
TGGACATCGCAGCTGGAAGGCTGGCATGGATAACGGCTGAGAGCGGCCGAGTGGTTATGCTGGATTTTCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail