Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|227000
Gene name
Locationscaffold_01:3319411..3319790
Strand-
Gene length (bp)379
Transcript length (bp)243
Coding sequence length (bp)243
Protein length (aa) 81

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup13143
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|227000 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|013640

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|227000
MPVMIYAAPQLDILQGVTGGGVPGVGPLNGGLGPVSNTVAGGGVVAVAEGAVVGGPRWKRLCPRTPPQMLNPCDL
FVQGC*
Coding >AgabiH39|227000
ATGCCCGTCATGATCTACGCCGCTCCACAACTTGACATTTTACAAGGGGTGACTGGTGGAGGAGTACCTGGAGTT
GGCCCATTGAATGGAGGGCTCGGACCGGTTTCAAACACCGTCGCTGGTGGAGGTGTTGTGGCAGTTGCTGAGGGT
GCCGTAGTTGGAGGACCTCGGTGGAAACGACTGTGTCCTAGAACGCCACCGCAGATGTTAAATCCATGCGATCTT
TTTGTGCAAGGCTGTTGA
Transcript >AgabiH39|227000
ATGCCCGTCATGATCTACGCCGCTCCACAACTTGACATTTTACAAGGGGTGACTGGTGGAGGAGTACCTGGAGTT
GGCCCATTGAATGGAGGGCTCGGACCGGTTTCAAACACCGTCGCTGGTGGAGGTGTTGTGGCAGTTGCTGAGGGT
GCCGTAGTTGGAGGACCTCGGTGGAAACGACTGTGTCCTAGAACGCCACCGCAGATGTTAAATCCATGCGATCTT
TTTGTGCAAGGCTGTTGA
Gene >AgabiH39|227000
ATGCCCGTCATGATCTACGCCGCTCCACAACTTGACATTTTACAAGGGGTGACTGGTGGAGGAGTACCTGGAGTT
GGCCCATTGAATGGAGGGCTCGGACCGGTTTCAAACACCGTCGCTGGTGGAGGTGTTGTGGCAGTTGCTGAGGGT
GCCGTAGGTGCCGTTACTGGAATTACTCGTGGTGGTCTTCTCGGACGATCTCAAAATGCCGCTGCAAAGTTGGAG
GACCTCGGTGGAAACGACTGTGTCCTAGAACGCCACCGCAGATGTTAAATCCATGGTGAGGACTCGAAGCATGCC
TTTCTTTTTCATCTACGATTCTCATAACTTACGATTCATCTCTGGTATTAACAGCGATCTTTTTGTGCAAGGCTG
TTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail