Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|221600
Gene name
Locationscaffold_01:3148585..3149503
Strand+
Gene length (bp)918
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 9.4E-07 212 298

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup9656
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|221600 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|285700
Agaricus bisporus var bisporus H39 AgabiH39|286900
Agaricus bisporus var bisporus H39 AgabiH39|435100

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|221600
MVASKRRPEPENSSESDQDSDSEEDEPILDKSKKKKQELPYRNVPALKPVVEVPPLPARYFKQPKEKITDKKINY
RHQAPVEKDIDVERVVDRNLAEKVPITHEELLALSPKYRSAYKDRMTRKRISANLQEIEDSSDESDVATTRPVVQ
VNLNNLSEAKIVQKRVQGLEGPSEESWVVGDPILQYLETLSEEERRSRVFVARESEMLRVVATTVNGVRNKEALL
DNGSQIISMSRDAAIACQLAWDPDITINMQSANNQVQRTCGLAKDVPFSMGGITVYLQVHVMENPAYRVLLGRPF
DVLHN*
Coding >AgabiH39|221600
ATGGTTGCATCTAAGAGACGGCCTGAACCTGAGAACAGTTCTGAAAGCGACCAAGATAGTGATTCTGAAGAGGAT
GAACCTATCTTAGACAAATCCAAGAAGAAGAAACAAGAATTGCCTTACAGAAATGTACCTGCACTTAAACCTGTA
GTGGAGGTACCCCCCTTACCTGCTCGATATTTCAAGCAGCCTAAAGAAAAGATAACAGATAAAAAGATAAACTAC
AGGCATCAGGCACCTGTAGAGAAAGATATAGACGTTGAAAGAGTAGTAGATAGGAATCTAGCTGAGAAAGTTCCA
ATAACTCATGAGGAACTCTTAGCCCTATCTCCGAAATACAGAAGCGCCTATAAAGATCGTATGACTAGGAAAAGA
ATCTCAGCGAACCTACAAGAGATTGAGGACAGTTCAGACGAATCTGATGTAGCTACTACTCGGCCTGTTGTTCAA
GTAAACTTGAACAACCTGAGTGAAGCTAAAATCGTTCAGAAGAGAGTCCAAGGTCTCGAAGGTCCGTCAGAAGAG
AGCTGGGTAGTTGGGGATCCAATCCTACAATACTTAGAGACTCTTTCCGAAGAAGAACGCCGTAGCAGAGTCTTT
GTGGCTAGAGAATCGGAAATGCTTCGCGTAGTAGCTACAACAGTAAACGGTGTCAGAAACAAAGAAGCCTTGCTA
GATAATGGCTCTCAGATAATCTCAATGAGTCGAGACGCAGCTATCGCTTGCCAGCTCGCTTGGGATCCTGATATC
ACTATCAACATGCAGAGTGCTAATAACCAAGTTCAAAGAACTTGTGGGTTAGCAAAAGATGTACCATTTTCCATG
GGCGGTATTACAGTCTATCTCCAAGTCCATGTAATGGAAAACCCAGCCTATAGAGTGCTCTTGGGACGTCCATTT
GATGTCTTACATAACTGA
Transcript >AgabiH39|221600
ATGGTTGCATCTAAGAGACGGCCTGAACCTGAGAACAGTTCTGAAAGCGACCAAGATAGTGATTCTGAAGAGGAT
GAACCTATCTTAGACAAATCCAAGAAGAAGAAACAAGAATTGCCTTACAGAAATGTACCTGCACTTAAACCTGTA
GTGGAGGTACCCCCCTTACCTGCTCGATATTTCAAGCAGCCTAAAGAAAAGATAACAGATAAAAAGATAAACTAC
AGGCATCAGGCACCTGTAGAGAAAGATATAGACGTTGAAAGAGTAGTAGATAGGAATCTAGCTGAGAAAGTTCCA
ATAACTCATGAGGAACTCTTAGCCCTATCTCCGAAATACAGAAGCGCCTATAAAGATCGTATGACTAGGAAAAGA
ATCTCAGCGAACCTACAAGAGATTGAGGACAGTTCAGACGAATCTGATGTAGCTACTACTCGGCCTGTTGTTCAA
GTAAACTTGAACAACCTGAGTGAAGCTAAAATCGTTCAGAAGAGAGTCCAAGGTCTCGAAGGTCCGTCAGAAGAG
AGCTGGGTAGTTGGGGATCCAATCCTACAATACTTAGAGACTCTTTCCGAAGAAGAACGCCGTAGCAGAGTCTTT
GTGGCTAGAGAATCGGAAATGCTTCGCGTAGTAGCTACAACAGTAAACGGTGTCAGAAACAAAGAAGCCTTGCTA
GATAATGGCTCTCAGATAATCTCAATGAGTCGAGACGCAGCTATCGCTTGCCAGCTCGCTTGGGATCCTGATATC
ACTATCAACATGCAGAGTGCTAATAACCAAGTTCAAAGAACTTGTGGGTTAGCAAAAGATGTACCATTTTCCATG
GGCGGTATTACAGTCTATCTCCAAGTCCATGTAATGGAAAACCCAGCCTATAGAGTGCTCTTGGGACGTCCATTT
GATGTCTTACATAACTGA
Gene >AgabiH39|221600
ATGGTTGCATCTAAGAGACGGCCTGAACCTGAGAACAGTTCTGAAAGCGACCAAGATAGTGATTCTGAAGAGGAT
GAACCTATCTTAGACAAATCCAAGAAGAAGAAACAAGAATTGCCTTACAGAAATGTACCTGCACTTAAACCTGTA
GTGGAGGTACCCCCCTTACCTGCTCGATATTTCAAGCAGCCTAAAGAAAAGATAACAGATAAAAAGATAAACTAC
AGGCATCAGGCACCTGTAGAGAAAGATATAGACGTTGAAAGAGTAGTAGATAGGAATCTAGCTGAGAAAGTTCCA
ATAACTCATGAGGAACTCTTAGCCCTATCTCCGAAATACAGAAGCGCCTATAAAGATCGTATGACTAGGAAAAGA
ATCTCAGCGAACCTACAAGAGATTGAGGACAGTTCAGACGAATCTGATGTAGCTACTACTCGGCCTGTTGTTCAA
GTAAACTTGAACAACCTGAGTGAAGCTAAAATCGTTCAGAAGAGAGTCCAAGGTCTCGAAGGTCCGTCAGAAGAG
AGCTGGGTAGTTGGGGATCCAATCCTACAATACTTAGAGACTCTTTCCGAAGAAGAACGCCGTAGCAGAGTCTTT
GTGGCTAGAGAATCGGAAATGCTTCGCGTAGTAGCTACAACAGTAAACGGTGTCAGAAACAAAGAAGCCTTGCTA
GATAATGGCTCTCAGATAATCTCAATGAGTCGAGACGCAGCTATCGCTTGCCAGCTCGCTTGGGATCCTGATATC
ACTATCAACATGCAGAGTGCTAATAACCAAGTTCAAAGAACTTGTGGGTTAGCAAAAGATGTACCATTTTCCATG
GGCGGTATTACAGTCTATCTCCAAGTCCATGTAATGGAAAACCCAGCCTATAGAGTGCTCTTGGGACGTCCATTT
GATGTCTTACATAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail