Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|112890
Gene name
Locationscaffold_08:2004272..2005632
Strand-
Gene length (bp)1360
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 6.3E-11 86 228

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999654

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH43_23 3.7E-66 87 289

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup8475
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|112890 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|112890

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|112890
MLGFRFGTLAILFSAMCTQSLAMPALGNVTSTSPELSMEMFKRAVSAPYVFTAFTSSSESNLYVYTSDDGTDFRL
LKGPTYTPPSGLIRDPSVILHTDGNYYIAYTTDWTGTNFAIASSSNLINWTRLATISTASSVITPVNTWAPEFFK
DPQTGKLNIIVSLSTGSFGPFLPYVFTASDSTLRSWSGPVRMSGISNAGLGYIDTFPLFHNNQYHIFTKAESNGK
KHIEHAVATSLTGPYSFVQTGDFAGWGQAEGPCVTVLPNGRFRLYADGFSSGKYITADSSDLFNWTPFQTIPGLS
GVVRHGTVLKQ*
Coding >AgabiH39|112890
ATGCTTGGTTTCAGATTCGGCACTTTGGCTATACTTTTTAGTGCAATGTGCACTCAGAGTCTCGCTATGCCTGCT
CTAGGCAACGTGACATCTACAAGCCCAGAATTATCGATGGAGATGTTTAAACGGGCCGTGTCTGCTCCCTATGTT
TTCACCGCCTTCACTTCTTCATCTGAATCCAATCTTTACGTTTATACCTCGGATGACGGAACGGATTTCAGGTTG
TTAAAAGGACCAACATATACCCCGCCATCGGGTCTTATTCGGGACCCTAGTGTCATTTTGCATACCGATGGGAAT
TACTACATCGCCTATACAACCGACTGGACGGGAACAAACTTTGCCATAGCTAGTAGTTCAAACCTTATCAACTGG
ACACGGCTTGCGACGATATCAACAGCATCTTCGGTCATAACACCAGTAAATACCTGGGCACCGGAATTTTTCAAG
GATCCTCAGACCGGCAAGCTCAACATCATTGTGTCACTTTCAACCGGAAGTTTTGGCCCATTCCTTCCTTATGTT
TTTACCGCCAGCGATTCGACCTTGAGATCATGGTCTGGTCCAGTCCGAATGTCTGGAATATCCAACGCTGGACTC
GGGTATATCGACACTTTCCCGCTGTTCCACAATAATCAATATCATATATTTACCAAGGCGGAGTCTAATGGGAAA
AAGCATATTGAACATGCCGTAGCTACTTCATTAACTGGACCATACTCTTTTGTCCAAACTGGTGACTTCGCGGGA
TGGGGGCAAGCCGAAGGACCATGTGTTACTGTTCTTCCTAATGGAAGATTCCGCCTCTACGCCGATGGATTTAGT
TCTGGCAAATATATCACCGCTGACTCTAGCGACCTTTTCAACTGGACTCCGTTCCAGACGATACCCGGTCTCAGT
GGGGTGGTAAGGCATGGGACGGTTTTGAAGCAATGA
Transcript >AgabiH39|112890
ATGCTTGGTTTCAGATTCGGCACTTTGGCTATACTTTTTAGTGCAATGTGCACTCAGAGTCTCGCTATGCCTGCT
CTAGGCAACGTGACATCTACAAGCCCAGAATTATCGATGGAGATGTTTAAACGGGCCGTGTCTGCTCCCTATGTT
TTCACCGCCTTCACTTCTTCATCTGAATCCAATCTTTACGTTTATACCTCGGATGACGGAACGGATTTCAGGTTG
TTAAAAGGACCAACATATACCCCGCCATCGGGTCTTATTCGGGACCCTAGTGTCATTTTGCATACCGATGGGAAT
TACTACATCGCCTATACAACCGACTGGACGGGAACAAACTTTGCCATAGCTAGTAGTTCAAACCTTATCAACTGG
ACACGGCTTGCGACGATATCAACAGCATCTTCGGTCATAACACCAGTAAATACCTGGGCACCGGAATTTTTCAAG
GATCCTCAGACCGGCAAGCTCAACATCATTGTGTCACTTTCAACCGGAAGTTTTGGCCCATTCCTTCCTTATGTT
TTTACCGCCAGCGATTCGACCTTGAGATCATGGTCTGGTCCAGTCCGAATGTCTGGAATATCCAACGCTGGACTC
GGGTATATCGACACTTTCCCGCTGTTCCACAATAATCAATATCATATATTTACCAAGGCGGAGTCTAATGGGAAA
AAGCATATTGAACATGCCGTAGCTACTTCATTAACTGGACCATACTCTTTTGTCCAAACTGGTGACTTCGCGGGA
TGGGGGCAAGCCGAAGGACCATGTGTTACTGTTCTTCCTAATGGAAGATTCCGCCTCTACGCCGATGGATTTAGT
TCTGGCAAATATATCACCGCTGACTCTAGCGACCTTTTCAACTGGACTCCGTTCCAGACGATACCCGGTCTCAGT
GGGGTGGTAAGGCATGGGACGGTTTTGAAGCAATGA
Gene >AgabiH39|112890
ATGCTTGGTTTCAGATTCGGCACTTTGGCTATACTTTTTAGTGCAATGTGCACTCAGAGTCTCGCTATGCCTGCT
CTAGGCAACGTGACATCTACAAGCCCAGAATTATCGATGGAGATGTTTAAACGGGCCGTGTCTGCTCCCTATGTT
TTCACCGCCTTCACTTCTTCATCTGAATCCAATCTTTACGTTTATACCTCGGATGACGGAACGGATTTCAGGTTG
TTAAAAGGACCAACATATACCCCGCCATCGGGTCTTATTCGGGACCCTAGTGTCATTTTGCATACCGAGTATGTG
TACTTATATGCGTATGGCGGGCGATCACATTGATGAAGCATTACAGTGGGAATTACTACATCGCCTGTACGTCTG
TTGCTGTTATCAAATGGTGAAACAGTCGTCAACGTTACTTGTTAAGATACAACCGACTGGACGGGAACAAACTTT
GCCATAGCTGTATGTTGATCTGTTTCGACTCGCCAATACTATTCGCGATGGTGTTGATTGATGGTGTTGATACTT
ATGCGGCTTTTGTAGAGTAGTTCAAACCTTATCAACTGGACACGGCTTGCGACGATATCAACAGCATCTTCGGTC
ATAACACCAGTAAATACCTGGGCACCGGTAAGCTCATAAAAAGTCGTCATGTCCATTCCCACTACTGTCCGTCTG
AAACATTTTTCTAGGAATTTTTCAAGGATCCTCAGACCGGCAAGCTCAACATCATTGTGTCACTTTCAACCGGAA
GTTTTGGCCCATTCCTTCCTTATGTTTTTACCGCCAGCGATTCGACCTTGAGATCATGGTCTGGTCCAGTCCGAA
TGTCTGGAATATCCAACGCTGGACTCGGGTATATCGACACTTTCCCGCTGTTCCACAAGTAAGTCGACAAATTGT
CTCATAACTCGATTACTTATAGCTGAAATTTATAGTAATCAATATCATATATTTACCAAGGCGGAGTCTAATGGG
AAAAAGCATATTGAACATGCCGTAGCTACTTCATTAACTGGACCATACTCTTTTGTCCAAACTGGTGACTTCGCG
GGATGGGGGCAAGCCGAAGGACCATGTGTTACTGTTCTTCCTAATGGAAGATTCCGCCTGTAAGTGACATCCATA
GTTCGAAGAGTGTTTTATTTTAAAACTCGACTTCTCAGCTACGCCGATGGATTTAGTTCTGGTGAGCGCTCCTGG
GGAAACACCTCCTTCCGGTTAGATGAATGCTAACTCGAGAAAATCATCAACAGGCAAATATATCACCGCTGACTC
TAGCGACCTTTTCAACTGGACTCCGTTCCAGACGATACCCGGTCTCAGTGGGGTGGTAAGGCATGGGACGGTTTT
GAAGCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail