© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH39|109940 |
| Gene name | |
| Location | scaffold_08:1222643..1223243 |
| Strand | - |
| Gene length (bp) | 600 |
| Transcript length (bp) | 600 |
| Coding sequence length (bp) | 600 |
| Protein length (aa) | 200 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF06413 | Neugrin | Neugrin | 1.6E-11 | 98 | 158 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|C4JXN2|RRG9_UNCRE | Required for respiratory growth protein 9, mitochondrial OS=Uncinocarpus reesii (strain UAMH 1704) GN=RRG9 PE=3 SV=1 | 80 | 184 | 2.0E-23 |
| sp|Q5AZJ0|RRG9_EMENI | Required for respiratory growth protein 9, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrg9 PE=3 SV=1 | 72 | 156 | 1.0E-22 |
| sp|E3L408|RRG9_PUCGT | Required for respiratory growth protein 9, mitochondrial OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=RRG9 PE=3 SV=2 | 81 | 151 | 2.0E-22 |
| sp|A2QCR5|RRG9_ASPNC | Required for respiratory growth protein 9, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrg9 PE=3 SV=1 | 79 | 186 | 3.0E-22 |
| sp|C5PBQ8|RRG9_COCP7 | Required for respiratory growth protein 9, mitochondrial OS=Coccidioides posadasii (strain C735) GN=RRG9 PE=3 SV=1 | 81 | 151 | 1.0E-20 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|C4JXN2|RRG9_UNCRE | Required for respiratory growth protein 9, mitochondrial OS=Uncinocarpus reesii (strain UAMH 1704) GN=RRG9 PE=3 SV=1 | 80 | 184 | 2.0E-23 |
| sp|Q5AZJ0|RRG9_EMENI | Required for respiratory growth protein 9, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrg9 PE=3 SV=1 | 72 | 156 | 1.0E-22 |
| sp|E3L408|RRG9_PUCGT | Required for respiratory growth protein 9, mitochondrial OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=RRG9 PE=3 SV=2 | 81 | 151 | 2.0E-22 |
| sp|A2QCR5|RRG9_ASPNC | Required for respiratory growth protein 9, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrg9 PE=3 SV=1 | 79 | 186 | 3.0E-22 |
| sp|C5PBQ8|RRG9_COCP7 | Required for respiratory growth protein 9, mitochondrial OS=Coccidioides posadasii (strain C735) GN=RRG9 PE=3 SV=1 | 81 | 151 | 1.0E-20 |
| sp|Q4X0T4|RRG9_ASPFU | Required for respiratory growth protein 9, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrg9 PE=3 SV=1 | 82 | 148 | 1.0E-20 |
| sp|B0XSW5|RRG9_ASPFC | Required for respiratory growth protein 9, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=rrg9 PE=3 SV=1 | 82 | 148 | 1.0E-20 |
| sp|A1DHD8|RRG9_NEOFI | Required for respiratory growth protein 9, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrg9 PE=3 SV=1 | 82 | 148 | 2.0E-20 |
| sp|D1ZQ10|RRG9_SORMK | Required for respiratory growth protein 9, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=RRG9 PE=3 SV=1 | 74 | 155 | 3.0E-20 |
| sp|Q0TY47|RRG9_PHANO | Required for respiratory growth protein 9, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRG9 PE=3 SV=1 | 74 | 177 | 4.0E-20 |
| sp|Q2UF33|RRG9_ASPOR | Required for respiratory growth protein 9, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrg9 PE=3 SV=1 | 82 | 156 | 4.0E-20 |
| sp|B8NHF2|RRG9_ASPFN | Required for respiratory growth protein 9, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rrg9 PE=3 SV=1 | 82 | 156 | 4.0E-20 |
| sp|Q9P5T3|RRG9_NEUCR | Required for respiratory growth protein 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrg9 PE=3 SV=1 | 74 | 155 | 7.0E-20 |
| sp|B6HDT2|RRG9_PENRW | Required for respiratory growth protein 9, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=rrg9 PE=3 SV=1 | 79 | 166 | 9.0E-20 |
| sp|A1C6R8|RRG9_ASPCL | Required for respiratory growth protein 9, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrg9 PE=3 SV=1 | 82 | 148 | 1.0E-19 |
| sp|C0SC25|RRG9_PARBP | Required for respiratory growth protein 9, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb03) GN=RRG9 PE=3 SV=2 | 82 | 151 | 3.0E-19 |
| sp|Q0CYR5|RRG9_ASPTN | Required for respiratory growth protein 9, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrg9 PE=3 SV=1 | 82 | 156 | 3.0E-19 |
| sp|C1GIF2|RRG9_PARBD | Required for respiratory growth protein 9, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=RRG9 PE=3 SV=1 | 82 | 151 | 3.0E-19 |
| sp|C5GEF3|RRG9_AJEDR | Required for respiratory growth protein 9, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=RRG9 PE=3 SV=1 | 71 | 151 | 1.0E-18 |
| sp|C5JS82|RRG9_AJEDS | Required for respiratory growth protein 9, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=RRG9 PE=3 SV=1 | 71 | 151 | 1.0E-18 |
| sp|A7EJ50|RRG9_SCLS1 | Required for respiratory growth protein 9, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrg9 PE=3 SV=1 | 82 | 152 | 1.0E-18 |
| sp|B6QGW6|RRG9_TALMQ | Required for respiratory growth protein 9, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=rrg9 PE=3 SV=1 | 66 | 148 | 9.0E-18 |
| sp|C5FNG9|RRG9_ARTOC | Required for respiratory growth protein 9, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=RRG9 PE=3 SV=1 | 70 | 154 | 1.0E-17 |
| sp|D4DHC4|RRG9_TRIVH | Required for respiratory growth protein 9, mitochondrial OS=Trichophyton verrucosum (strain HKI 0517) GN=RRG9 PE=3 SV=1 | 82 | 154 | 6.0E-17 |
| sp|D4AKN8|RRG9_ARTBC | Required for respiratory growth protein 9, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=RRG9 PE=3 SV=1 | 82 | 194 | 7.0E-17 |
| sp|E4UQC3|RRG9_ARTGP | Required for respiratory growth protein 9, mitochondrial OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=RRG9 PE=3 SV=1 | 82 | 179 | 9.0E-17 |
| sp|B8MLF7|RRG9_TALSN | Required for respiratory growth protein 9, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=rrg9 PE=3 SV=1 | 60 | 148 | 2.0E-16 |
| sp|Q2GNN3|RRG9_CHAGB | Required for respiratory growth protein 9, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRG9 PE=3 SV=1 | 78 | 162 | 1.0E-15 |
| sp|B2W722|RRG9_PYRTR | Required for respiratory growth protein 9, mitochondrial OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=rrg9 PE=3 SV=1 | 2 | 177 | 2.0E-15 |
| sp|E3REX1|RRG9_PYRTT | Required for respiratory growth protein 9, mitochondrial OS=Pyrenophora teres f. teres (strain 0-1) GN=rrg9 PE=3 SV=1 | 82 | 177 | 5.0E-15 |
| sp|A7TIC4|RRG9_VANPO | Required for respiratory growth protein 9, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRG9 PE=3 SV=1 | 81 | 151 | 4.0E-14 |
| sp|C5DD31|RRG9_LACTC | Required for respiratory growth protein 9, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RRG9 PE=3 SV=1 | 81 | 164 | 2.0E-13 |
| sp|P40156|RRG9_YEAST | Required for respiratory growth protein 9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRG9 PE=1 SV=1 | 81 | 151 | 2.0E-12 |
| sp|C8ZG19|RRG9_YEAS8 | Required for respiratory growth protein 9, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RRG9 PE=3 SV=1 | 81 | 151 | 2.0E-12 |
| sp|A6ZRM7|RRG9_YEAS7 | Required for respiratory growth protein 9, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=RRG9 PE=3 SV=1 | 81 | 151 | 2.0E-12 |
| sp|B5VQJ9|RRG9_YEAS6 | Required for respiratory growth protein 9, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RRG9 PE=3 SV=1 | 81 | 151 | 2.0E-12 |
| sp|C7GPE4|RRG9_YEAS2 | Required for respiratory growth protein 9, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=RRG9 PE=3 SV=1 | 81 | 151 | 2.0E-12 |
| sp|B3LP57|RRG9_YEAS1 | Required for respiratory growth protein 9, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RRG9 PE=3 SV=1 | 81 | 151 | 2.0E-12 |
| sp|C4R331|RRG9_PICPG | Required for respiratory growth protein 9, mitochondrial OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=RRG9 PE=3 SV=1 | 81 | 184 | 2.0E-11 |
| sp|Q6CQ76|RRG9_KLULA | Required for respiratory growth protein 9, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRG9 PE=3 SV=1 | 49 | 152 | 2.0E-11 |
| sp|Q6FMV8|RRG9_CANGA | Required for respiratory growth protein 9, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRG9 PE=3 SV=1 | 81 | 173 | 2.0E-11 |
| sp|P0C8Z6|Y8135_DICDI | Putative neugrin-like protein DDB_G0288135 OS=Dictyostelium discoideum GN=DDB_G0288135 PE=3 SV=1 | 97 | 150 | 6.0E-11 |
| sp|Q75E45|RRG9_ASHGO | Required for respiratory growth protein 9, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRG9 PE=3 SV=1 | 81 | 185 | 2.0E-10 |
| sp|A5DKF1|RRG9_PICGU | Required for respiratory growth protein 9, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRG9 PE=3 SV=2 | 81 | 183 | 2.0E-10 |
| sp|Q6BUM6|RRG9_DEBHA | Required for respiratory growth protein 9, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRG9 PE=3 SV=1 | 81 | 199 | 1.0E-08 |
| sp|C5DTR1|RRG9_ZYGRC | Required for respiratory growth protein 9, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=RRG9 PE=3 SV=1 | 82 | 175 | 3.0E-08 |
| sp|A5DZ02|RRG9_LODEL | Required for respiratory growth protein 9, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRG9 PE=3 SV=1 | 82 | 148 | 4.0E-08 |
| sp|A3LTV8|RRG9_PICST | Required for respiratory growth protein 9, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRG9 PE=3 SV=2 | 81 | 174 | 2.0E-07 |
| sp|Q9NPE2|NGRN_HUMAN | Neugrin OS=Homo sapiens GN=NGRN PE=1 SV=2 | 98 | 155 | 2.0E-07 |
| sp|Q5R7E7|NGRN_PONAB | Neugrin OS=Pongo abelii GN=NGRN PE=2 SV=2 | 98 | 155 | 2.0E-07 |
| sp|O14211|RRG9_SCHPO | Required for respiratory growth protein 9, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrg9 PE=3 SV=2 | 81 | 144 | 5.0E-07 |
| sp|Q3T1H2|NGRN_RAT | Neugrin OS=Rattus norvegicus GN=Ngrn PE=2 SV=3 | 98 | 155 | 6.0E-07 |
| sp|Q99KS2|NGRN_MOUSE | Neugrin OS=Mus musculus GN=Ngrn PE=2 SV=3 | 98 | 155 | 1.0E-06 |
| sp|Q2HJC0|NGRN_BOVIN | Neugrin OS=Bos taurus GN=NGRN PE=2 SV=2 | 98 | 155 | 1.0E-06 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 18 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH39|109940 MSCIRAVRCFSTRPSSSSSPAVSAAGRRKWGIGGLPSPKSILNDDSIPVDLSEDNDAVNGIRPNTPPRHLRRPPA KPTPNEWKSHRVALKSTFPEGWSPPRKLSREAMDGLRDMHKLDPAKFSTPILADRFKISPEAVRRILKSKWEPPQ EKRVKWAMQARQHRNEKGEYMRQTLLKEMREANDILSAKQYRGDLTLKG* |
| Coding | >AgabiH39|109940 ATGTCCTGTATACGCGCTGTCCGCTGCTTTTCAACGCGACCGTCGTCGTCGTCGTCACCCGCTGTCTCTGCCGCA GGGCGTCGTAAATGGGGTATCGGTGGACTGCCCTCGCCCAAATCCATCCTCAACGACGACTCCATCCCCGTTGAC CTCTCCGAAGACAACGACGCCGTCAATGGTATTCGACCAAACACTCCCCCTCGCCATCTTCGTCGACCCCCTGCC AAACCTACGCCGAACGAATGGAAATCTCACCGTGTCGCCCTCAAATCTACATTTCCCGAGGGATGGTCACCACCC CGTAAATTATCACGAGAGGCAATGGACGGACTACGCGATATGCATAAGCTTGACCCAGCCAAGTTTTCAACCCCT ATTCTAGCCGACAGGTTTAAAATAAGCCCAGAAGCTGTGAGAAGGATCCTCAAGAGTAAATGGGAGCCTCCGCAG GAGAAAAGAGTAAAATGGGCTATGCAAGCTCGGCAGCATAGAAATGAGAAGGGGGAATATATGAGGCAGACATTG TTGAAAGAGATGCGAGAGGCGAATGATATTCTATCCGCGAAGCAGTACAGAGGCGATTTAACATTGAAAGGTTAA |
| Transcript | >AgabiH39|109940 ATGTCCTGTATACGCGCTGTCCGCTGCTTTTCAACGCGACCGTCGTCGTCGTCGTCACCCGCTGTCTCTGCCGCA GGGCGTCGTAAATGGGGTATCGGTGGACTGCCCTCGCCCAAATCCATCCTCAACGACGACTCCATCCCCGTTGAC CTCTCCGAAGACAACGACGCCGTCAATGGTATTCGACCAAACACTCCCCCTCGCCATCTTCGTCGACCCCCTGCC AAACCTACGCCGAACGAATGGAAATCTCACCGTGTCGCCCTCAAATCTACATTTCCCGAGGGATGGTCACCACCC CGTAAATTATCACGAGAGGCAATGGACGGACTACGCGATATGCATAAGCTTGACCCAGCCAAGTTTTCAACCCCT ATTCTAGCCGACAGGTTTAAAATAAGCCCAGAAGCTGTGAGAAGGATCCTCAAGAGTAAATGGGAGCCTCCGCAG GAGAAAAGAGTAAAATGGGCTATGCAAGCTCGGCAGCATAGAAATGAGAAGGGGGAATATATGAGGCAGACATTG TTGAAAGAGATGCGAGAGGCGAATGATATTCTATCCGCGAAGCAGTACAGAGGCGATTTAACATTGAAAGGTTAA |
| Gene | >AgabiH39|109940 ATGTCCTGTATACGCGCTGTCCGCTGCTTTTCAACGCGACCGTCGTCGTCGTCGTCACCCGCTGTCTCTGCCGCA GGGCGTCGTAAATGGGGTATCGGTGGACTGCCCTCGCCCAAATCCATCCTCAACGACGACTCCATCCCCGTTGAC CTCTCCGAAGACAACGACGCCGTCAATGGTATTCGACCAAACACTCCCCCTCGCCATCTTCGTCGACCCCCTGCC AAACCTACGCCGAACGAATGGAAATCTCACCGTGTCGCCCTCAAATCTACATTTCCCGAGGGATGGTCACCACCC CGTAAATTATCACGAGAGGCAATGGACGGACTACGCGATATGCATAAGCTTGACCCAGCCAAGTTTTCAACCCCT ATTCTAGCCGACAGGTTTAAAATAAGCCCAGAAGCTGTGAGAAGGATCCTCAAGAGTAAATGGGAGCCTCCGCAG GAGAAAAGAGTAAAATGGGCTATGCAAGCTCGGCAGCATAGAAATGAGAAGGGGGAATATATGAGGCAGACATTG TTGAAAGAGATGCGAGAGGCGAATGATATTCTATCCGCGAAGCAGTACAGAGGCGATTTAACATTGAAAGGTTAA |