Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|103800
Gene name
Locationscaffold_07:1589519..1592450
Strand+
Gene length (bp)2931
Transcript length (bp)2052
Coding sequence length (bp)2052
Protein length (aa) 684

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 9.9E-78 86 543

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LPS1|LACS6_ARATH Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana GN=LACS6 PE=1 SV=1 18 682 3.0E-138
sp|Q8LKS5|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 54 682 1.0E-136
sp|P33121|ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens GN=ACSL1 PE=1 SV=1 14 669 2.0E-133
sp|Q9JID6|ACSL1_CAVPO Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1 14 669 5.0E-130
sp|P41216|ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 59 669 1.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LPS1|LACS6_ARATH Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana GN=LACS6 PE=1 SV=1 18 682 3.0E-138
sp|Q8LKS5|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 54 682 1.0E-136
sp|P33121|ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens GN=ACSL1 PE=1 SV=1 14 669 2.0E-133
sp|Q9JID6|ACSL1_CAVPO Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1 14 669 5.0E-130
sp|P41216|ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 59 669 1.0E-129
sp|P18163|ACSL1_RAT Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus GN=Acsl1 PE=1 SV=1 59 669 1.0E-129
sp|O88813|ACSL5_RAT Long-chain-fatty-acid--CoA ligase 5 OS=Rattus norvegicus GN=Acsl5 PE=1 SV=1 8 669 2.0E-127
sp|Q9ULC5|ACSL5_HUMAN Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens GN=ACSL5 PE=1 SV=1 8 669 4.0E-124
sp|Q8JZR0|ACSL5_MOUSE Long-chain-fatty-acid--CoA ligase 5 OS=Mus musculus GN=Acsl5 PE=1 SV=1 8 669 5.0E-124
sp|Q9UKU0|ACSL6_HUMAN Long-chain-fatty-acid--CoA ligase 6 OS=Homo sapiens GN=ACSL6 PE=2 SV=4 54 669 3.0E-122
sp|Q55DR6|FCSA_DICDI Fatty acyl-CoA synthetase A OS=Dictyostelium discoideum GN=fcsA PE=1 SV=1 20 669 6.0E-121
sp|P33124|ACSL6_RAT Long-chain-fatty-acid--CoA ligase 6 OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 54 669 4.0E-118
sp|Q91WC3|ACSL6_MOUSE Long-chain-fatty-acid--CoA ligase 6 OS=Mus musculus GN=Acsl6 PE=1 SV=1 54 669 8.0E-118
sp|Q9XIA9|LACS2_ARATH Long chain acyl-CoA synthetase 2 OS=Arabidopsis thaliana GN=LACS2 PE=2 SV=1 42 670 5.0E-109
sp|Q9C7W4|LACS3_ARATH Long chain acyl-CoA synthetase 3 OS=Arabidopsis thaliana GN=LACS3 PE=2 SV=1 49 679 3.0E-104
sp|Q9T009|LACS5_ARATH Long chain acyl-CoA synthetase 5 OS=Arabidopsis thaliana GN=LACS5 PE=2 SV=1 58 670 4.0E-104
sp|Q9T0A0|LACS4_ARATH Long chain acyl-CoA synthetase 4 OS=Arabidopsis thaliana GN=LACS4 PE=2 SV=1 72 670 6.0E-104
sp|O22898|LACS1_ARATH Long chain acyl-CoA synthetase 1 OS=Arabidopsis thaliana GN=LACS1 PE=2 SV=1 58 675 7.0E-101
sp|Q1ZXQ4|FCSB_DICDI Fatty acyl-CoA synthetase B OS=Dictyostelium discoideum GN=fcsB PE=2 SV=1 51 669 3.0E-97
sp|P39518|LCF2_YEAST Long-chain-fatty-acid--CoA ligase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA2 PE=1 SV=1 68 667 3.0E-80
sp|O35547|ACSL4_RAT Long-chain-fatty-acid--CoA ligase 4 OS=Rattus norvegicus GN=Acsl4 PE=1 SV=1 54 681 2.0E-78
sp|O60488|ACSL4_HUMAN Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens GN=ACSL4 PE=1 SV=2 54 681 5.0E-78
sp|Q9QUJ7|ACSL4_MOUSE Long-chain-fatty-acid--CoA ligase 4 OS=Mus musculus GN=Acsl4 PE=1 SV=2 54 681 1.0E-77
sp|O95573|ACSL3_HUMAN Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens GN=ACSL3 PE=1 SV=3 25 671 5.0E-74
sp|Q9CZW4|ACSL3_MOUSE Long-chain-fatty-acid--CoA ligase 3 OS=Mus musculus GN=Acsl3 PE=1 SV=2 25 671 9.0E-74
sp|Q63151|ACSL3_RAT Long-chain-fatty-acid--CoA ligase 3 OS=Rattus norvegicus GN=Acsl3 PE=1 SV=1 25 671 9.0E-74
sp|Q9SJD4|LACS8_ARATH Long chain acyl-CoA synthetase 8 OS=Arabidopsis thaliana GN=LACS8 PE=1 SV=1 69 671 2.0E-73
sp|Q5R668|ACSL3_PONAB Long-chain-fatty-acid--CoA ligase 3 OS=Pongo abelii GN=ACSL3 PE=2 SV=2 25 671 3.0E-73
sp|Q9CAP8|LACS9_ARATH Long chain acyl-CoA synthetase 9, chloroplastic OS=Arabidopsis thaliana GN=LACS9 PE=1 SV=1 54 666 5.0E-73
sp|Q9P7D7|LCF2_SCHPO Long-chain-fatty-acid--CoA ligase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf2 PE=3 SV=1 27 670 3.0E-57
sp|P30624|LCF1_YEAST Long-chain-fatty-acid--CoA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA1 PE=1 SV=1 127 674 1.0E-52
sp|O60135|LCF1_SCHPO Long-chain-fatty-acid--CoA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf1 PE=3 SV=1 32 670 2.0E-50
sp|P44446|LCFH_HAEIN Putative long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0002 PE=3 SV=1 125 670 8.0E-50
sp|B2HGV4|FAC15_MYCMM Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD15 PE=3 SV=1 99 667 3.0E-47
sp|P47912|LCF4_YEAST Long-chain-fatty-acid--CoA ligase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA4 PE=1 SV=1 219 674 6.0E-47
sp|P39002|LCF3_YEAST Long-chain-fatty-acid--CoA ligase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA3 PE=1 SV=1 241 674 3.0E-46
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 83 589 4.0E-44
sp|Q7TYX8|FAC15_MYCBO Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD15 PE=3 SV=2 125 683 7.0E-44
sp|O53521|FAC15_MYCTU Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD15 PE=1 SV=3 127 683 5.0E-43
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 53 669 3.0E-38
sp|P16405|ORA_PLAFN Octapeptide-repeat antigen (Fragment) OS=Plasmodium falciparum (isolate NF7 / Ghana) PE=2 SV=1 105 666 2.0E-33
sp|Q9V3S9|BGM_DROME Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster GN=bgm PE=2 SV=1 89 582 1.0E-32
sp|Q5FVE4|ACBG2_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Homo sapiens GN=ACSBG2 PE=1 SV=2 84 666 1.0E-30
sp|Q2XU92|ACBG2_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus GN=Acsbg2 PE=1 SV=1 51 572 8.0E-29
sp|Q7ZYC4|ACBG2_XENLA Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopus laevis GN=acsbg2 PE=2 SV=1 84 666 1.0E-28
sp|Q5ZKR7|ACBG2_CHICK Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus GN=ACSBG2 PE=2 SV=2 122 572 1.0E-27
sp|P9WQ53|FAD11_MYCTU Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD11 PE=3 SV=1 243 669 3.0E-27
sp|P9WQ52|FAD11_MYCTO Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD11 PE=3 SV=1 243 669 3.0E-27
sp|A1L1K7|ACBG2_RAT Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Rattus norvegicus GN=Acsbg2 PE=2 SV=1 51 581 3.0E-27
sp|Q4R4P9|ACBG1_MACFA Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Macaca fascicularis GN=ACSBG1 PE=2 SV=2 44 683 4.0E-26
sp|Q96GR2|ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens GN=ACSBG1 PE=2 SV=2 44 683 2.0E-25
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 196 565 1.0E-24
sp|Q924N5|ACBG1_RAT Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus GN=Acsbg1 PE=1 SV=1 70 683 2.0E-23
sp|Q9LK39|AAE16_ARATH Probable acyl-activating enzyme 16, chloroplastic OS=Arabidopsis thaliana GN=AAE16 PE=2 SV=1 243 670 3.0E-23
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 90 569 5.0E-23
sp|Q99PU5|ACBG1_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Mus musculus GN=Acsbg1 PE=1 SV=1 70 683 7.0E-23
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 195 565 1.0E-22
sp|Q2KHW5|ACBG1_BOVIN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Bos taurus GN=ACSBG1 PE=2 SV=1 123 683 3.0E-22
sp|Q9V3U0|BGML_DROME Long-chain-fatty-acid--CoA ligase bubblegum-like OS=Drosophila melanogaster GN=CG4500 PE=2 SV=1 76 582 4.0E-22
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 242 566 4.0E-22
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 92 564 4.0E-21
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 244 565 6.0E-21
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 243 564 7.0E-21
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 171 588 1.0E-20
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 196 565 7.0E-20
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 244 565 2.0E-19
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 244 565 3.0E-19
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 171 588 4.0E-19
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 233 569 4.0E-19
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 49 562 5.0E-19
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 165 588 1.0E-18
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 234 565 2.0E-18
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 196 565 2.0E-18
sp|Q9LQ12|4CLL1_ARATH 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 246 569 5.0E-18
sp|Q8W471|AAE15_ARATH Long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15, chloroplastic OS=Arabidopsis thaliana GN=AAE15 PE=1 SV=1 244 683 6.0E-18
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 127 565 2.0E-17
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 242 586 2.0E-17
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 248 571 4.0E-17
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 244 564 4.0E-17
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 242 586 8.0E-17
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 242 586 8.0E-17
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 172 571 9.0E-17
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 90 558 2.0E-16
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 79 586 3.0E-16
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 125 571 3.0E-16
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 404 564 4.0E-16
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 247 573 5.0E-16
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 247 573 5.0E-16
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 244 599 5.0E-16
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 244 599 5.0E-16
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 162 573 7.0E-16
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 401 575 7.0E-15
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 75 571 8.0E-15
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 243 565 1.0E-14
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 235 586 3.0E-14
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 125 571 9.0E-14
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 455 564 1.0E-13
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 240 569 2.0E-13
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 85 571 3.0E-13
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 240 565 3.0E-13
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 102 569 4.0E-13
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 401 590 1.0E-12
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 86 571 5.0E-12
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 455 588 1.0E-11
sp|Q00594|ALKK_PSEOL Medium-chain-fatty-acid--CoA ligase OS=Pseudomonas oleovorans GN=alkK PE=3 SV=1 161 585 2.0E-11
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 246 583 3.0E-11
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 480 571 1.0E-10
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 480 571 1.0E-10
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 480 571 1.0E-10
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 480 571 1.0E-10
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 480 571 1.0E-10
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 480 571 1.0E-10
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 480 571 1.0E-10
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 480 571 1.0E-10
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 480 571 1.0E-10
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 487 571 1.0E-10
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 487 571 1.0E-10
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 480 571 1.0E-10
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 487 571 1.0E-10
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 487 571 1.0E-10
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 480 571 1.0E-10
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 487 571 1.0E-10
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 487 571 1.0E-10
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 481 571 1.0E-10
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 481 571 1.0E-10
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 481 571 1.0E-10
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 481 571 1.0E-10
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 481 571 2.0E-10
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 481 571 2.0E-10
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 247 562 2.0E-10
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 487 571 2.0E-10
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 487 571 2.0E-10
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 487 571 2.0E-10
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 480 571 2.0E-10
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 480 571 2.0E-10
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 487 571 2.0E-10
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 487 571 2.0E-10
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 487 571 2.0E-10
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 487 571 3.0E-10
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 487 571 3.0E-10
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 247 571 3.0E-10
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 241 577 3.0E-10
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 447 571 4.0E-10
sp|P31686|4CL1_SOYBN 4-coumarate--CoA ligase 1 (Fragment) OS=Glycine max PE=2 SV=1 401 565 4.0E-10
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 480 629 5.0E-10
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 487 571 5.0E-10
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 487 571 6.0E-10
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 487 571 7.0E-10
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 487 571 7.0E-10
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 487 571 8.0E-10
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 458 571 9.0E-10
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 458 571 1.0E-09
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 487 571 1.0E-09
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 458 571 2.0E-09
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 92 620 2.0E-09
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 447 571 3.0E-09
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 444 607 3.0E-09
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 487 571 4.0E-09
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 487 571 4.0E-09
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 487 571 4.0E-09
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 458 562 4.0E-09
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 465 569 5.0E-09
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 470 569 8.0E-09
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 249 585 9.0E-09
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 249 585 9.0E-09
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 483 571 1.0E-08
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 466 564 1.0E-08
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 465 569 1.0E-08
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 487 569 1.0E-08
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 400 577 3.0E-08
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 483 564 3.0E-08
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 456 564 5.0E-08
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 484 577 6.0E-08
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 456 564 2.0E-07
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 483 571 2.0E-07
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 483 571 2.0E-07
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 483 571 2.0E-07
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 483 571 2.0E-07
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 483 571 2.0E-07
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 483 571 2.0E-07
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 406 571 3.0E-07
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 483 571 3.0E-07
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 486 583 3.0E-07
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 483 573 4.0E-07
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 479 596 9.0E-07
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 486 571 1.0E-06
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 486 571 1.0E-06
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 459 571 1.0E-06
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 459 584 3.0E-06
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 460 602 3.0E-06
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 465 566 3.0E-06
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 460 602 3.0E-06
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 406 615 4.0E-06
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 487 569 6.0E-06
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 483 577 7.0E-06
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 427 571 8.0E-06
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 196 298 9.0E-06
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 458 571 9.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1286
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|058770
Agaricus bisporus var bisporus H39 AgabiH39|103800 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|058770
Agaricus bisporus var bisporus H97 AgabiH97|103800
Rhodonia placenta FPRL280 RhoplFPRL280|12_41

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|103800
MSLNREKIVGWPNPIPFNRQSVIVPGTKRPGQTAHYRNAIWGLIDENTPTTFLTLDQIFEDGLKVGREREFLGHR
SIISTNPLKFADRYEWITYGEVDEKRRCIGSAMHSLFSKDEVGGGEYQTVGIWSANRPEWQIIDIATQSYEKVSV
SLYETLGKDVVEYIINHAHITMVFATSNHISTLLTLAPKIPCLKLIIVIDKVPVETAKLFAEWGQSNGIKVQEWD
EFEAYGMANLIEPIRPTPETVASICYTSGTTDTPKGAVLKHKALAISITSQLYGLHMPDNATLLSYLPLAHIYER
MCEFIIMALGGRIGYFSGDPLRLLEDAQILKPHFFPSVPRILNRIYQAAMAAGNVPGLKGKIFRKAVETKLENFR
ATGKITHPLWDNIVFRKIQNVLGGRVQLISSAAAPINTEILNFLKIAFACEFIEGCGSSSFYRRETFSCTKTWPD
DRTASGLVGPPTPVTEIKLVDVPDMGYTSEDKPNPRGELCMRGLCQFTEYYKDPKNTRETIDEEGWLHSGDVGEI
DYAGRFKIIDRVKNIMKLAQGEYVALEKVESLMCSHPFIAQIFIYGDSFQSYLVAIVVPDPIALAQIASRIFGRN
IAPEDQVGLQEVIKDVRMNTHILKELTKHGQSVGLKGFEMIKRIHLTLTLFSIDNDALTPTMKYKQSSLMTIKKV
ANMFGALY*
Coding >AgabiH39|103800
ATGTCTTTGAACAGGGAAAAAATCGTCGGCTGGCCCAATCCTATTCCCTTTAACAGACAGTCTGTCATTGTTCCC
GGAACGAAGCGACCTGGACAAACTGCTCACTATCGCAATGCCATTTGGGGACTTATTGATGAGAATACTCCGACC
ACTTTTTTGACGTTGGACCAAATTTTTGAGGACGGACTGAAGGTTGGCAGAGAGCGCGAGTTTCTAGGTCATCGT
TCTATCATTTCAACAAATCCTCTCAAATTCGCGGACCGTTATGAATGGATTACCTATGGCGAGGTTGATGAGAAA
AGACGATGTATTGGTAGTGCCATGCATAGTCTTTTCAGCAAGGACGAGGTCGGAGGGGGTGAATACCAAACCGTT
GGTATCTGGTCGGCCAATCGTCCAGAGTGGCAAATTATCGATATTGCTACACAATCTTACGAAAAGGTTTCCGTC
AGCTTATACGAGACATTAGGCAAGGACGTCGTTGAATACATTATCAACCACGCGCATATCACTATGGTTTTCGCG
ACTTCGAACCATATTTCTACCCTCCTCACACTCGCTCCGAAGATTCCCTGCCTGAAATTAATTATCGTCATTGAC
AAAGTTCCTGTTGAAACTGCTAAACTCTTTGCTGAATGGGGTCAATCTAACGGCATCAAAGTACAGGAATGGGAT
GAATTTGAGGCGTATGGTATGGCTAATCTCATCGAACCTATCAGACCCACACCAGAGACTGTCGCATCTATCTGT
TACACTTCTGGAACCACCGATACGCCTAAAGGCGCTGTTTTGAAACATAAGGCGCTTGCTATATCTATCACCAGC
CAATTGTACGGCCTGCACATGCCAGACAATGCCACTCTCCTTTCTTACTTACCTTTGGCTCATATCTACGAACGA
ATGTGCGAATTCATTATAATGGCTCTTGGTGGTCGAATCGGATATTTCTCCGGCGATCCTCTTCGTCTCCTAGAA
GATGCCCAAATACTCAAGCCTCATTTTTTTCCTTCGGTACCTCGCATCCTAAATCGCATATATCAGGCAGCCATG
GCAGCTGGCAATGTTCCTGGACTAAAAGGGAAAATCTTTAGGAAGGCCGTTGAAACCAAACTCGAGAATTTCCGT
GCTACTGGCAAGATTACGCATCCTCTTTGGGATAACATAGTTTTTCGAAAAATTCAAAACGTTCTAGGCGGTCGG
GTCCAGCTCATTTCATCTGCCGCGGCACCTATCAATACGGAAATCCTGAACTTCCTCAAAATTGCATTTGCGTGC
GAATTTATTGAAGGGTGCGGCTCTAGCAGCTTTTACCGCCGCGAAACTTTTTCGTGTACCAAAACCTGGCCGGAC
GATCGGACTGCTAGTGGCCTTGTTGGCCCTCCCACACCTGTTACCGAGATTAAATTGGTGGACGTCCCTGACATG
GGCTACACGTCCGAGGATAAACCAAACCCTCGCGGCGAGTTGTGTATGCGTGGTCTCTGCCAATTTACCGAGTAC
TACAAGGATCCAAAGAATACGCGAGAAACAATTGATGAGGAAGGTTGGCTGCACAGTGGTGATGTCGGCGAAATC
GATTATGCTGGTCGCTTTAAAATCATCGATAGAGTCAAGAATATCATGAAACTCGCGCAGGGCGAATATGTTGCC
CTCGAGAAGGTTGAAAGTTTAATGTGCTCTCATCCTTTCATTGCACAAATATTCATCTATGGCGACTCGTTTCAA
TCATATCTGGTCGCCATTGTCGTTCCCGATCCGATTGCGCTCGCTCAAATCGCTTCACGGATTTTTGGAAGAAAT
ATCGCACCAGAGGATCAGGTCGGCCTCCAGGAGGTAATCAAGGACGTTCGCATGAATACGCATATTTTGAAGGAG
CTTACGAAGCATGGTCAGAGCGTCGGCCTCAAAGGGTTCGAAATGATCAAGCGAATCCATTTGACTCTTACTCTC
TTCTCGATTGACAACGATGCACTCACCCCCACCATGAAGTACAAACAGTCGTCTTTAATGACAATCAAGAAGGTC
GCCAATATGTTCGGGGCGTTATACTAA
Transcript >AgabiH39|103800
ATGTCTTTGAACAGGGAAAAAATCGTCGGCTGGCCCAATCCTATTCCCTTTAACAGACAGTCTGTCATTGTTCCC
GGAACGAAGCGACCTGGACAAACTGCTCACTATCGCAATGCCATTTGGGGACTTATTGATGAGAATACTCCGACC
ACTTTTTTGACGTTGGACCAAATTTTTGAGGACGGACTGAAGGTTGGCAGAGAGCGCGAGTTTCTAGGTCATCGT
TCTATCATTTCAACAAATCCTCTCAAATTCGCGGACCGTTATGAATGGATTACCTATGGCGAGGTTGATGAGAAA
AGACGATGTATTGGTAGTGCCATGCATAGTCTTTTCAGCAAGGACGAGGTCGGAGGGGGTGAATACCAAACCGTT
GGTATCTGGTCGGCCAATCGTCCAGAGTGGCAAATTATCGATATTGCTACACAATCTTACGAAAAGGTTTCCGTC
AGCTTATACGAGACATTAGGCAAGGACGTCGTTGAATACATTATCAACCACGCGCATATCACTATGGTTTTCGCG
ACTTCGAACCATATTTCTACCCTCCTCACACTCGCTCCGAAGATTCCCTGCCTGAAATTAATTATCGTCATTGAC
AAAGTTCCTGTTGAAACTGCTAAACTCTTTGCTGAATGGGGTCAATCTAACGGCATCAAAGTACAGGAATGGGAT
GAATTTGAGGCGTATGGTATGGCTAATCTCATCGAACCTATCAGACCCACACCAGAGACTGTCGCATCTATCTGT
TACACTTCTGGAACCACCGATACGCCTAAAGGCGCTGTTTTGAAACATAAGGCGCTTGCTATATCTATCACCAGC
CAATTGTACGGCCTGCACATGCCAGACAATGCCACTCTCCTTTCTTACTTACCTTTGGCTCATATCTACGAACGA
ATGTGCGAATTCATTATAATGGCTCTTGGTGGTCGAATCGGATATTTCTCCGGCGATCCTCTTCGTCTCCTAGAA
GATGCCCAAATACTCAAGCCTCATTTTTTTCCTTCGGTACCTCGCATCCTAAATCGCATATATCAGGCAGCCATG
GCAGCTGGCAATGTTCCTGGACTAAAAGGGAAAATCTTTAGGAAGGCCGTTGAAACCAAACTCGAGAATTTCCGT
GCTACTGGCAAGATTACGCATCCTCTTTGGGATAACATAGTTTTTCGAAAAATTCAAAACGTTCTAGGCGGTCGG
GTCCAGCTCATTTCATCTGCCGCGGCACCTATCAATACGGAAATCCTGAACTTCCTCAAAATTGCATTTGCGTGC
GAATTTATTGAAGGGTGCGGCTCTAGCAGCTTTTACCGCCGCGAAACTTTTTCGTGTACCAAAACCTGGCCGGAC
GATCGGACTGCTAGTGGCCTTGTTGGCCCTCCCACACCTGTTACCGAGATTAAATTGGTGGACGTCCCTGACATG
GGCTACACGTCCGAGGATAAACCAAACCCTCGCGGCGAGTTGTGTATGCGTGGTCTCTGCCAATTTACCGAGTAC
TACAAGGATCCAAAGAATACGCGAGAAACAATTGATGAGGAAGGTTGGCTGCACAGTGGTGATGTCGGCGAAATC
GATTATGCTGGTCGCTTTAAAATCATCGATAGAGTCAAGAATATCATGAAACTCGCGCAGGGCGAATATGTTGCC
CTCGAGAAGGTTGAAAGTTTAATGTGCTCTCATCCTTTCATTGCACAAATATTCATCTATGGCGACTCGTTTCAA
TCATATCTGGTCGCCATTGTCGTTCCCGATCCGATTGCGCTCGCTCAAATCGCTTCACGGATTTTTGGAAGAAAT
ATCGCACCAGAGGATCAGGTCGGCCTCCAGGAGGTAATCAAGGACGTTCGCATGAATACGCATATTTTGAAGGAG
CTTACGAAGCATGGTCAGAGCGTCGGCCTCAAAGGGTTCGAAATGATCAAGCGAATCCATTTGACTCTTACTCTC
TTCTCGATTGACAACGATGCACTCACCCCCACCATGAAGTACAAACAGTCGTCTTTAATGACAATCAAGAAGGTC
GCCAATATGTTCGGGGCGTTATACTAA
Gene >AgabiH39|103800
ATGTCTTTGAACAGGGAAAAAATCGTCGGCTGGCCCAATCCTATTCCCTTTAACAGACAGTCTGTCATTGTTCCC
GGAACGAAGCGACCTGGACAAACTGGTTTGTCAATGTCAACCTAATTCGAGCACTCCTAACTAATATTTCTTAAC
TTCAGCTCACTATCGCAATGGTACATGGATTCAACATTTCCTCCCATAACACTCTCCTAATCTCATCCAGCCATT
TGGGGACTTATTGATGAGAATACTCCGACCACTTTTTTGACGTTGGACCAAATTTTTGAGGACGGACTGAAGGTT
GGCAGAGAGCGCGAGTTTCTAGGTCATCGTTCTATCATTTCAACAAATCCTCTCAAATTCGCGGACCGTTATGAA
TGGATTACCTATGGCGAGGTTGATGAGAAAAGACGATGTATTGGTAGTGCCATGCATAGTCTTTTCAGCAAGGAC
GAGGTCGGAGGGGGTGAATACCAAACCGTTGGTATCTGGTCGGCCAATCGTCCAGGTATATGTCATTTGAATTTT
GCACGTAGACGTCTGTCTAACAAAACCAGAGTGGCAAATTATCGATATTGCTACACAATCTTACGAAAAGGTTTC
CGTCAGCTTATACGAGACATTAGGCAAGGACGTCGTTGGTAAGATCCACTCTTTTTTGACATCCGAGCTCTCAAT
AATTTCTTCTTCTTTCTTCAGAATACATGTAATGTGGCTCCCTTGACCGTCACCTACGCCCTCATATCTGATTTC
TACTAGTATCAACCACGCGCATATCACTATGGTTTTCGCGACTTCGAACCATATTTCTACCCTCCTCACACTCGC
TCCGAAGATTCCCTGCCTGAAATTAATTATCGTCATTGACAAAGTTCCTGTTGAAACTGCTAAACTCTTTGCTGA
ATGGGGTCAATCTAACGGCATCAAAGTACAGGAATGGGATGAATGTGCGTTGATCTTCTGATTAACATTCTATCT
GCAAATCTCATTTCAATTTCAGTTGAGGCGTATGGTATGGCTAATCTCATCGAACCTATCAGACCCACACCAGAG
ACTGTCGCATCTATCTGTTACACTTCTGTGAGTAACATCTTTCTTTCGCGCTTGCCATTGTTTCATCTTGCTTGT
AGGGAACCACCGATACGCCTAAAGGTAAAAACTCTATCGAGTAGGTTATTTTTTCTGACGGTCATATCCATTAGG
CGCTGTTTTGAAACATAAGGCGCTTGCTATATCTATCACCAGCCAATTGTACGGCCTGCACATGCCAGACAATGC
CACTCTCCTTTCTTACTTACCTTTGGCTCATATCTACGAAGTATCTTCCTTCACTTTATTCTCTTGGAGAAGCTG
ACTCTATCTGCTGGTAGCGAATGTGCGAATTCATTATAATGGCTCTTGGTGGTCGAATCGGATATTTCTCCGGCG
ATCCTCTTCGTCTCCTAGAAGATGCCCAAATACTCAAGCCTCATTTTTTTCCTTCGGTACCTCGCATCCTAAATC
GCATATATCAGGCAGCCATGGCAGCTGGCAATGTTCCTGGACTAAAAGGGAAAATCTTTAGGAAGGCCGTTGAAA
CCAAACTCGAGAATTTCCGTGCTACTGGCAAGATTACGCATCCTCTTTGGGATAACATAGTTTTTCGAAAAGTGA
GAACTTTTGTTATTTATCTCAACTGACTTGTTTTACAATTCCTACCAGATTCAAAACGTTCTAGGCGGTCGGGTC
CAGCTCATTTCATCTGCCGCGGCACCTATCAATACGGAAATCCTGAACTTCCTCAAAATTGCATTTGCGTGCGAA
TTTATTGAAGGTATGCTTCTGCAAAGTGATACTTTTATATACAAAAGTAACGCTTATTGGCAGGGTGCGGCTCTA
GCAGCTTTTACCGCCGCGAAACTTTTTGTGGGAGTAGCTGACGGACGTTTCGATGTAGGTATGGCATGACGGAAA
ATATGGCAGCGTGTACCAAAACCTGGCCGGACGATCGGACTGCTAGTGGCCTTGTTGGCCCTCCCACACCTGTTA
CCGAGATTAAATTGGTGGACGTCCCTGACATGGGCTACACGTCCGAGGATAAACCAAACCCTCGCGGCGAGTTGT
GTATGCGTGGTCTCTGCCAATTTACCGAGTACTACAAGGGCAAGTTAGCTAGATGACTCTTAATTATCTCAGCTC
ATTGCCTATACAGATCCAAAGAATACGCGAGAAACAATTGATGAGGAAGGTTGGCTGCACAGTGGTGATGTCGGC
GAAATCGATTATGCTGGTCGCTTTAAAATCATCGATAGAGTCAAGAATATCATGAAACTCGCGCAGGGCGAATAT
GTTGCCCTCGAGAAGGTTGAAAGTTTAATGTGCTCTCATCCTTTCATTGCACAAATATTCATCTATGGCGACTCG
TTTCAATCATATCTGGTCGCCATTGTCGTTCCCGATCCGATTGCGCTCGCTCAAATCGCTTCACGGATTTTTGGA
AGAAATATCGCACCAGAGGATCAGGTCGGCCTCCAGGAGGTAATCAAGGACGTTCGCATGAATACGCATATTTTG
AAGGAGCTTACGAAGCATGGTCAGAGCGTCGGCCTCAAAGGGTGAGCAGCTTTCAACTACGAATGGAATTTTTTA
TGGACTTTTCGTGACGTAGGTTCGAAATGATCAAGCGAATCCATTTGACTCTTACTCTCTTCTCGATTGACAACG
ATGCACTCACCCCCACCATGAAGTACAAACGTAAAAATGTTGCGAAGCTTTATCAGACTGAAATTGCTCACCTCT
ACTCCTTGGGCGAACCTTCCTCTAATAATACATCGAGCCAGAGTCGTCTTTAATGACAATCAAGAAGGTCGCCAA
TATGGTATAGATTCTAGGTTCTATCTCTGTTCTTGTCTCATGAATGCTAAGCAAATGTTATAGTTCGGGGCGTTA
TACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail