Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|102590
Gene name
Locationscaffold_07:1282398..1284079
Strand+
Gene length (bp)1681
Transcript length (bp)1509
Coding sequence length (bp)1509
Protein length (aa) 503

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13679 Methyltransf_32 Methyltransferase domain 5.0E-23 111 275

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96FB5|RRNAD_HUMAN Protein RRNAD1 OS=Homo sapiens GN=RRNAD1 PE=2 SV=2 110 341 1.0E-09
sp|Q6AYG0|RRNAD_RAT Protein RRNAD1 OS=Rattus norvegicus GN=Rrnad1 PE=2 SV=1 108 460 6.0E-09
sp|Q8BZG5|RRNAD_MOUSE Protein RRNAD1 OS=Mus musculus GN=Rrnad1 PE=2 SV=1 108 460 8.0E-09

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup6900
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|102590 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|102590
Rhodonia placenta FPRL280 RhoplFPRL280|157_6
Rhodonia placenta FPRL280 RhoplFPRL280|731_1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|102590
MHDTIKKLGHLHAFLISSLVQFLLRSHPNDIATNPEADIIQGCGEWFYWCREKLDGWPEIVNYYMTGDGESTLPG
DLRNILDEVRSLQLDRLPISLEGDFPQIEETGMSPKKVHEVSRMVAYILQIIRINKWDPSVLRIVDVGAGQGYLT
RSLKAQLPQTKILALDADEAQTSGAQRWERRLLPLPSNENPPITHKTIHVTPEALYSTIDTWITEESPEGIDAKQ
EMLPVLLVGLHACGSLTPDVIKVLGQRSSGKTQWRIASMVVVGCCYNLMNPGDFPLSKSLKERSPTIDLPVSAYH
LAAQVPNHWLSSLSPPTPVPSVKLALRKVTWRALLGKKLRQNVQVNHPPVEINLTPGRQLPWSRLPTAKVHNFQL
NEEGTGATPEMRRLGRLKDTAYTDWETFVDVAGKKMGIDFGEKVKVVEEDMRMERLLECFHTLRCLVGTVVESAI
ILDRLVWVDELVKSEGRSDLRTSVVNLFDQATGSGRNVAIVVAPKVPSLTEV*
Coding >AgabiH39|102590
ATGCATGACACTATAAAGAAACTCGGACATCTCCATGCGTTTCTAATATCATCGCTTGTACAGTTCTTACTCCGC
TCACACCCCAATGACATTGCTACGAATCCAGAAGCAGATATTATTCAAGGCTGCGGTGAATGGTTCTACTGGTGT
CGCGAAAAACTCGATGGTTGGCCGGAGATAGTCAATTATTACATGACAGGCGATGGGGAGTCAACCTTGCCGGGC
GACTTGAGAAATATTCTCGATGAGGTCAGAAGTCTACAACTAGACCGACTTCCGATTTCATTGGAAGGTGACTTT
CCGCAAATTGAGGAGACTGGGATGTCACCAAAGAAAGTACACGAAGTATCTCGTATGGTCGCATATATCCTTCAA
ATTATTCGGATTAACAAATGGGACCCATCCGTGTTACGGATTGTGGATGTCGGGGCTGGCCAAGGCTATCTAACG
AGATCTTTGAAGGCTCAGTTACCACAAACAAAAATCCTTGCTTTGGATGCGGATGAAGCGCAGACAAGTGGAGCT
CAACGTTGGGAAAGAAGATTGTTACCCCTTCCTTCGAATGAAAATCCGCCAATCACTCATAAAACTATACACGTT
ACTCCGGAAGCGCTATATTCTACCATTGATACGTGGATCACAGAAGAGAGTCCAGAAGGGATTGATGCGAAGCAG
GAGATGCTACCTGTTCTGCTCGTTGGTTTACATGCTTGTGGTTCTCTTACACCTGATGTCATAAAGGTATTGGGT
CAGAGGTCTTCAGGAAAGACGCAATGGAGGATCGCTAGTATGGTGGTCGTTGGTTGCTGTTATAATCTTATGAAC
CCGGGAGACTTCCCTCTATCCAAGTCTCTCAAAGAGAGATCTCCAACAATCGATCTTCCGGTGTCAGCTTATCAT
CTTGCAGCGCAGGTGCCGAATCATTGGCTTTCAAGTCTATCACCTCCTACACCTGTTCCTTCAGTCAAACTTGCA
CTTCGCAAGGTGACTTGGCGAGCTTTACTCGGGAAGAAATTGCGACAAAATGTACAAGTCAATCACCCACCGGTT
GAAATAAACTTGACACCTGGACGACAACTTCCTTGGTCTCGATTACCAACTGCTAAAGTGCACAACTTTCAATTG
AATGAAGAGGGTACTGGTGCAACGCCTGAAATGCGTCGTCTCGGACGATTGAAGGATACCGCATATACCGATTGG
GAAACATTTGTGGATGTCGCTGGAAAGAAGATGGGTATAGATTTTGGAGAGAAGGTGAAGGTTGTGGAGGAGGAT
ATGAGGATGGAGCGTCTACTTGAATGTTTTCATACATTGCGGTGTTTGGTGGGGACGGTAGTTGAGAGTGCTATC
ATTCTTGACCGATTAGTGTGGGTAGATGAACTTGTAAAGAGCGAGGGACGATCGGATTTGCGGACTTCGGTCGTG
AATTTGTTTGATCAGGCTACTGGAAGTGGGAGGAATGTGGCCATTGTGGTAGCGCCAAAGGTACCTTCATTAACT
GAGGTTTAA
Transcript >AgabiH39|102590
ATGCATGACACTATAAAGAAACTCGGACATCTCCATGCGTTTCTAATATCATCGCTTGTACAGTTCTTACTCCGC
TCACACCCCAATGACATTGCTACGAATCCAGAAGCAGATATTATTCAAGGCTGCGGTGAATGGTTCTACTGGTGT
CGCGAAAAACTCGATGGTTGGCCGGAGATAGTCAATTATTACATGACAGGCGATGGGGAGTCAACCTTGCCGGGC
GACTTGAGAAATATTCTCGATGAGGTCAGAAGTCTACAACTAGACCGACTTCCGATTTCATTGGAAGGTGACTTT
CCGCAAATTGAGGAGACTGGGATGTCACCAAAGAAAGTACACGAAGTATCTCGTATGGTCGCATATATCCTTCAA
ATTATTCGGATTAACAAATGGGACCCATCCGTGTTACGGATTGTGGATGTCGGGGCTGGCCAAGGCTATCTAACG
AGATCTTTGAAGGCTCAGTTACCACAAACAAAAATCCTTGCTTTGGATGCGGATGAAGCGCAGACAAGTGGAGCT
CAACGTTGGGAAAGAAGATTGTTACCCCTTCCTTCGAATGAAAATCCGCCAATCACTCATAAAACTATACACGTT
ACTCCGGAAGCGCTATATTCTACCATTGATACGTGGATCACAGAAGAGAGTCCAGAAGGGATTGATGCGAAGCAG
GAGATGCTACCTGTTCTGCTCGTTGGTTTACATGCTTGTGGTTCTCTTACACCTGATGTCATAAAGGTATTGGGT
CAGAGGTCTTCAGGAAAGACGCAATGGAGGATCGCTAGTATGGTGGTCGTTGGTTGCTGTTATAATCTTATGAAC
CCGGGAGACTTCCCTCTATCCAAGTCTCTCAAAGAGAGATCTCCAACAATCGATCTTCCGGTGTCAGCTTATCAT
CTTGCAGCGCAGGTGCCGAATCATTGGCTTTCAAGTCTATCACCTCCTACACCTGTTCCTTCAGTCAAACTTGCA
CTTCGCAAGGTGACTTGGCGAGCTTTACTCGGGAAGAAATTGCGACAAAATGTACAAGTCAATCACCCACCGGTT
GAAATAAACTTGACACCTGGACGACAACTTCCTTGGTCTCGATTACCAACTGCTAAAGTGCACAACTTTCAATTG
AATGAAGAGGGTACTGGTGCAACGCCTGAAATGCGTCGTCTCGGACGATTGAAGGATACCGCATATACCGATTGG
GAAACATTTGTGGATGTCGCTGGAAAGAAGATGGGTATAGATTTTGGAGAGAAGGTGAAGGTTGTGGAGGAGGAT
ATGAGGATGGAGCGTCTACTTGAATGTTTTCATACATTGCGGTGTTTGGTGGGGACGGTAGTTGAGAGTGCTATC
ATTCTTGACCGATTAGTGTGGGTAGATGAACTTGTAAAGAGCGAGGGACGATCGGATTTGCGGACTTCGGTCGTG
AATTTGTTTGATCAGGCTACTGGAAGTGGGAGGAATGTGGCCATTGTGGTAGCGCCAAAGGTACCTTCATTAACT
GAGGTTTAA
Gene >AgabiH39|102590
ATGCATGACACTATAAAGAAACTCGGACATCTCCATGCGTTTCTAATATCATCGCTTGTACAGTTCTTACTCCGC
TCACACCCCAATGACATTGCTACGAATCCAGAAGCAGATATTATTCAAGGCTGCGGTGAATGGTTCTACTGGTGT
CGCGAAAAACTCGATGGTTGGCCGGAGATAGTCAATTATTACATGACAGGCGATGGGTGCGTCCTTCAAAGTCCT
TTCAGGTTCACTGTATAAAATTGTCAGGGAGTCAACCTTGCCGGGCGACTTGAGAAATATTCTCGATGAGGTCAG
AAGTCTACAACTAGACCGACTTCCGATTTCATTGGAAGGTGACTTTCCGCAAATTGAGGAGACTGGGATGTCACC
AAAGAAAGTACACGAAGTATCTCGTATGGTCGCATATATCCTTCAAATTATTCGGATTAACAAATGGGACCCATC
CGTGTTACGGATTGTGGATGTCGGGGCTGGCCAAGTCTGTTCAAAATATTATTTTATCATTCGTGTGCTATGGAT
CAGTTAACCAGAATGTCTTTTTCTTTACCTTAGGGCTATCTAACGAGATCTTTGAAGGCTCAGTTACCACAAACA
AAAATCCTTGCTTTGGATGCGGATGAAGCGCAGACAAGTGGAGCTCAACGTTGGGAAAGAAGATTGTTACCCCTT
CCTTCGAATGAAAATCCGCCAATCACTCATAAAACTATACACGTTACTCCGGAAGCGCTATATTCTACCATTGAT
ACGTGGATCACAGAAGAGAGTCCAGAAGGGATTGATGCGAAGCAGGAGATGCTACCTGTTCTGCTCGTTGGTTTA
CATGCTTGTGGTTCTCTTACACCTGATGTCATAAAGGTATTGGGTCAGAGGTCTTCAGGAAAGACGCAATGGAGG
ATCGCTAGTATGGTGGTCGTTGGTTGCTGTTATAATCTTATGAACCCGGGAGGTACGCGTTTCCTTTACGCCGCC
AAATTTGATTGACTGACGTGTGTGTCAAGACTTCCCTCTATCCAAGTCTCTCAAAGAGAGATCTCCAACAATCGA
TCTTCCGGTGTCAGCTTATCATCTTGCAGCGCAGGTGCCGAATCATTGGCTTTCAAGTCTATCACCTCCTACACC
TGTTCCTTCAGTCAAACTTGCACTTCGCAAGGTGACTTGGCGAGCTTTACTCGGGAAGAAATTGCGACAAAATGT
ACAAGTCAATCACCCACCGGTTGAAATAAACTTGACACCTGGACGACAACTTCCTTGGTCTCGATTACCAACTGC
TAAAGTGCACAACTTTCAATTGAATGAAGAGGGTACTGGTGCAACGCCTGAAATGCGTCGTCTCGGACGATTGAA
GGATACCGCATATACCGATTGGGAAACATTTGTGGATGTCGCTGGAAAGAAGATGGGTATAGATTTTGGAGAGAA
GGTGAAGGTTGTGGAGGAGGATATGAGGATGGAGCGTCTACTTGAATGTTTTCATACATTGCGGTGTTTGGTGGG
GACGGTAGTTGAGAGTGCTATCATTCTTGACCGATTAGTGTGGGTAGATGAACTTGTAAAGAGCGAGGGACGATC
GGATTTGCGGACTTCGGTCGTGAATTTGTTTGATCAGGCTACTGGAAGTGGGAGGAATGTGGCCATTGTGGTAGC
GCCAAAGGTACCTTCATTAACTGAGGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail