Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|099500
Gene name
Locationscaffold_07:601039..602588
Strand+
Gene length (bp)1549
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 1.0E-06 12 53
PF00646 F-box F-box domain 5.6E-05 13 45

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1593
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016750
Agaricus bisporus var bisporus H39 AgabiH39|049060
Agaricus bisporus var bisporus H39 AgabiH39|099480
Agaricus bisporus var bisporus H39 AgabiH39|099490
Agaricus bisporus var bisporus H39 AgabiH39|099500 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|400700
Agaricus bisporus var bisporus H39 AgabiH39|400800
Agaricus bisporus var bisporus H97 AgabiH97|016680
Agaricus bisporus var bisporus H97 AgabiH97|016750
Agaricus bisporus var bisporus H97 AgabiH97|049060
Agaricus bisporus var bisporus H97 AgabiH97|099480
Agaricus bisporus var bisporus H97 AgabiH97|099490
Agaricus bisporus var bisporus H97 AgabiH97|099500
Agaricus bisporus var bisporus H97 AgabiH97|099810
Agaricus bisporus var bisporus H97 AgabiH97|099830

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|099500
MEDADQDVQGLTSLPTEVLSQILMYVDGSDIPALQQTCQTLRSVTMARQFWYNRIHRLCQEHVVSPPEEELEDYS
IAELEHWTMRRIRARNTCPANIQVRTQDIYSGDTFLVPGGRWLLSPYDDRIYFVDLDSNNLRMRQLFVPKICVPF
TWFRKKIGHRIWLDHKAPRLSFRFLSCIADTDIDIQFTWVTIHQVNLIGHGANATLTGQIIATFRCPKARKPRYL
IAFNDRYFVQGRGYQSLITDGGLEIFDYRQALGCSRYPKLMDSHTLPFSEDCSTHLEFINEDVLAIYCDVTDTYH
IFNIESPTSFKLLHEIKLPVLPFDFSRTYWTPEASLMTFTSSPISSTIKRIYGLVIPHDSELRPWTVELGTFAGS
RIDARITFEPGIFVSLSYNSKASTISRLVHKWDYTCESSCGGPTPISYLEQDVDVDQLEKLVAFDEDTGRSVYFS
KGGPRKFEIAVAG*
Coding >AgabiH39|099500
ATGGAAGATGCTGATCAGGATGTTCAAGGACTCACGTCACTTCCCACCGAGGTGCTCTCTCAGATCCTCATGTAT
GTAGACGGTTCAGACATACCCGCGCTTCAGCAAACGTGCCAAACTTTGCGTTCCGTTACAATGGCTCGGCAGTTT
TGGTATAACCGCATTCATCGACTCTGCCAAGAACATGTCGTCTCCCCACCTGAAGAAGAATTAGAAGACTATTCT
ATAGCTGAACTCGAGCACTGGACCATGCGACGAATTCGTGCCAGGAATACTTGCCCTGCGAACATACAAGTTCGC
ACTCAAGATATATACAGCGGGGATACGTTTCTCGTTCCCGGTGGTCGGTGGCTTCTGAGTCCTTATGATGATCGG
ATATACTTCGTCGACTTGGACAGCAACAATCTACGAATGCGCCAATTGTTCGTTCCGAAAATCTGTGTCCCGTTC
ACCTGGTTCCGCAAAAAAATCGGACATCGTATATGGTTAGACCATAAAGCACCGCGATTGTCTTTCCGCTTTCTA
AGTTGCATTGCCGACACCGATATTGATATACAGTTTACGTGGGTAACTATTCATCAGGTCAATCTGATTGGCCAT
GGTGCCAATGCAACTCTCACTGGTCAGATCATTGCTACCTTTCGATGCCCCAAGGCGAGAAAACCACGTTATTTA
ATTGCCTTCAATGATCGCTATTTTGTCCAAGGTCGAGGCTACCAGTCTTTGATTACAGATGGGGGATTGGAAATT
TTCGACTATAGACAAGCCTTAGGATGCTCTCGTTACCCTAAGTTGATGGACAGCCATACCCTTCCCTTCAGTGAA
GATTGTTCTACCCATTTGGAGTTCATCAACGAGGACGTTCTTGCTATCTACTGCGACGTAACAGATACCTATCAT
ATCTTCAACATAGAGTCACCAACGTCGTTCAAGCTTTTGCATGAAATCAAACTGCCTGTGTTACCATTTGACTTT
TCCAGGACCTATTGGACACCTGAAGCCTCGCTGATGACGTTCACCTCGTCCCCAATTTCGTCTACCATCAAAAGA
ATTTATGGGCTCGTTATACCTCATGACAGCGAGCTTCGTCCATGGACGGTCGAGCTAGGAACATTCGCAGGAAGC
AGGATTGATGCGCGCATCACCTTCGAGCCTGGTATATTCGTCTCACTGTCCTATAATTCCAAGGCAAGCACAATT
TCGCGTCTTGTTCATAAATGGGACTACACATGTGAATCATCCTGTGGTGGACCGACTCCTATATCGTATCTGGAG
CAGGATGTAGATGTGGATCAGCTGGAGAAACTCGTCGCGTTTGATGAAGATACAGGGCGCTCAGTTTATTTTAGC
AAAGGAGGTCCAAGAAAATTCGAGATAGCTGTAGCGGGTTGA
Transcript >AgabiH39|099500
ATGGAAGATGCTGATCAGGATGTTCAAGGACTCACGTCACTTCCCACCGAGGTGCTCTCTCAGATCCTCATGTAT
GTAGACGGTTCAGACATACCCGCGCTTCAGCAAACGTGCCAAACTTTGCGTTCCGTTACAATGGCTCGGCAGTTT
TGGTATAACCGCATTCATCGACTCTGCCAAGAACATGTCGTCTCCCCACCTGAAGAAGAATTAGAAGACTATTCT
ATAGCTGAACTCGAGCACTGGACCATGCGACGAATTCGTGCCAGGAATACTTGCCCTGCGAACATACAAGTTCGC
ACTCAAGATATATACAGCGGGGATACGTTTCTCGTTCCCGGTGGTCGGTGGCTTCTGAGTCCTTATGATGATCGG
ATATACTTCGTCGACTTGGACAGCAACAATCTACGAATGCGCCAATTGTTCGTTCCGAAAATCTGTGTCCCGTTC
ACCTGGTTCCGCAAAAAAATCGGACATCGTATATGGTTAGACCATAAAGCACCGCGATTGTCTTTCCGCTTTCTA
AGTTGCATTGCCGACACCGATATTGATATACAGTTTACGTGGGTAACTATTCATCAGGTCAATCTGATTGGCCAT
GGTGCCAATGCAACTCTCACTGGTCAGATCATTGCTACCTTTCGATGCCCCAAGGCGAGAAAACCACGTTATTTA
ATTGCCTTCAATGATCGCTATTTTGTCCAAGGTCGAGGCTACCAGTCTTTGATTACAGATGGGGGATTGGAAATT
TTCGACTATAGACAAGCCTTAGGATGCTCTCGTTACCCTAAGTTGATGGACAGCCATACCCTTCCCTTCAGTGAA
GATTGTTCTACCCATTTGGAGTTCATCAACGAGGACGTTCTTGCTATCTACTGCGACGTAACAGATACCTATCAT
ATCTTCAACATAGAGTCACCAACGTCGTTCAAGCTTTTGCATGAAATCAAACTGCCTGTGTTACCATTTGACTTT
TCCAGGACCTATTGGACACCTGAAGCCTCGCTGATGACGTTCACCTCGTCCCCAATTTCGTCTACCATCAAAAGA
ATTTATGGGCTCGTTATACCTCATGACAGCGAGCTTCGTCCATGGACGGTCGAGCTAGGAACATTCGCAGGAAGC
AGGATTGATGCGCGCATCACCTTCGAGCCTGGTATATTCGTCTCACTGTCCTATAATTCCAAGGCAAGCACAATT
TCGCGTCTTGTTCATAAATGGGACTACACATGTGAATCATCCTGTGGTGGACCGACTCCTATATCGTATCTGGAG
CAGGATGTAGATGTGGATCAGCTGGAGAAACTCGTCGCGTTTGATGAAGATACAGGGCGCTCAGTTTATTTTAGC
AAAGGAGGTCCAAGAAAATTCGAGATAGCTGTAGCGGGTTGA
Gene >AgabiH39|099500
ATGGAAGATGCTGATCAGGATGTTCAAGGACTCACGTCACTTCCCACCGAGGTGCTCTCTCAGATCCTCATGTAT
GTAGACGGTTCAGACATACCCGCGCTTCAGCAAGTGTGTTTTGTCGCCATTTTTTTCGCATACGAACGATGTCTG
ATATTCAGAAGACGTGCCAAACTTTGCGTTCCGTTACAATGGCTCGGCAGTTTTGGTATAACCGCATTCATCGAC
TCTGCCAAGAACATGTCGTCTCCCCACCTGAAGAAGAATTAGAAGACTATTCTATAGCTGAACTCGAGCACTGGA
CCATGCGACGAATTCGTGCCAGGAATACTTGCCCTGCGAACATACAAGTTCGCACTCAAGATATATACAGCGGGG
ATACGTTTCTCGTTCCCGGTGGTCGGTGGCTTCTGAGTCCTTATGATGATCGGATATACTTCGTCGACTTGGACA
GCAACAATCTACGAATGCGCCAATTGTTCGTTCCGAAAATCTGTGTCCCGTTCACCTGGTTCCGCAAAAAAATCG
GACATCGTATATGGTTAGACCATAAAGCACCGCGATTGTCTTTCCGCTTTCTAAGTTGCATTGCCGACACCGGTG
CGTTAGTTGAGTGTCATATTCAATGGGACTTACTGGTGCACAGATATTGATATACAGTTTACGTGGGTAACTATT
CATCAGGTCAATCTGATTGGCCATGGTGCCAATGCAACTCTCACTGGTCAGATCATTGCTACCTTTCGATGCCCC
AAGGCGAGAAAACCACGTTATTTAATTGCCTTCAATGATCGCTATTTTGTCCAAGGTCGAGGCTACCAGTCTTTG
ATTACAGATGGGGGATTGGAAATTTTCGACTATAGACAAGCCTTAGGATGCTCTCGTTACCCTAAGTTGATGGAC
AGCCATACCCTTCCCTTCAGTGAAGATTGTTCTACCGTCTGTGCATTCTCTGATCATGGCTCGTACTTGGACTCA
TATCAATTCTTACGAACAGCATTTGGAGTTCATCAACGAGGACGTTCTTGCTATCTACTGCGACGTAACAGATAC
CTATCATATCTTCAACATAGAGTCACCAACGTCGTTCAAGCTTTTGCATGAAATCAAACTGCCTGTGTTACCATT
TGACTTTTCCAGGACCTATTGGACACCTGAAGCCTCGCTGATGACGTTCACCTCGTCCCCAATTTCGTCTACCAT
CAAAAGAATTTATGGGCTCGTTATACCTCATGACAGCGAGCTTCGTCCATGGACGGTCGAGCTAGGAACATTCGC
AGGAAGCAGGATTGATGCGCGCATCACCTTCGAGCCTGGTATATTCGTCTCACTGTCCTATAATTCCAAGGCAAG
CACAATTTCGCGTCTTGTTCATAAATGGGACTACACATGTGAATCATCCTGTGGTGGACCGACTCCTATATCGTA
TCTGGAGCAGGATGTAGATGTGGATCAGCTGGAGAAACTCGTCGCGTTTGATGAAGATACAGGGCGCTCAGTTTA
TTTTAGCAAAGGAGGTCCAAGAAAATTCGAGATAGCTGTAGCGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail