Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|095720
Gene name
Locationscaffold_06b:404311..406402
Strand+
Gene length (bp)2091
Transcript length (bp)1149
Coding sequence length (bp)1149
Protein length (aa) 383

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20152 DUF6534 Family of unknown function (DUF6534) 9.4E-16 217 299

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 100 122 22
3 137 159 22
4 172 194 22
5 209 228 19
6 253 275 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup19
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|004100
Agaricus bisporus var bisporus H39 AgabiH39|406100
Agaricus bisporus var bisporus H39 AgabiH39|386300
Agaricus bisporus var bisporus H39 AgabiH39|386200
Agaricus bisporus var bisporus H39 AgabiH39|102060
Agaricus bisporus var bisporus H39 AgabiH39|095970
Agaricus bisporus var bisporus H39 AgabiH39|103490
Agaricus bisporus var bisporus H39 AgabiH39|095720 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|022930
Agaricus bisporus var bisporus H39 AgabiH39|020260
Agaricus bisporus var bisporus H39 AgabiH39|020250
Agaricus bisporus var bisporus H39 AgabiH39|095960
Agaricus bisporus var bisporus H97 AgabiH97|096260
Agaricus bisporus var bisporus H97 AgabiH97|103490
Agaricus bisporus var bisporus H97 AgabiH97|103480
Agaricus bisporus var bisporus H97 AgabiH97|103470
Agaricus bisporus var bisporus H97 AgabiH97|102060
Agaricus bisporus var bisporus H97 AgabiH97|096250
Agaricus bisporus var bisporus H97 AgabiH97|020260
Agaricus bisporus var bisporus H97 AgabiH97|095960
Agaricus bisporus var bisporus H97 AgabiH97|095720
Agaricus bisporus var bisporus H97 AgabiH97|022930
Agaricus bisporus var bisporus H97 AgabiH97|020250
Agaricus bisporus var bisporus H97 AgabiH97|004100
Agaricus bisporus var bisporus H97 AgabiH97|095970
Rhodonia placenta FPRL280 RhoplFPRL280|25_45
Rhodonia placenta FPRL280 RhoplFPRL280|168_9
Rhodonia placenta FPRL280 RhoplFPRL280|227_13
Rhodonia placenta FPRL280 RhoplFPRL280|435_5

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|095720
MTGPEKKEYTYGKYDWNHLIFRELAWFEVEIILLHPRNPHVGTTDTPSPIRGNPMDGPAETAHGPMLIGTLLNVL
LFGVMIAQVYIYYTSYRRDRLVLKLFVFAVFLADTVNSVLDVVYIYMCLIVHFGDLEYLKFTNWQFSSAPVLTGI
IALMVQLFFAWRIQLLTRNWFLVAVVSMLSLASAICATIITWFVTVVPQFDRFQEFQGVVIGWLSCAAAADILIT
TILRMHKTGFKKSDIVIDRIIRMTVQTGLVTSVVAIIDLSLYLGIPTSGIHLLFNFTLCKLYSNSLMSSLNARSR
LRHGSQGQTTLENMFGEEPGQSISHGNPIGGWREHNVDMLRAGEKPQAIQLDSMGHPKSGVFVHVESHEMRDIQS
HGNDNKS*
Coding >AgabiH39|095720
ATGACAGGTCCCGAGAAAAAAGAGTATACTTACGGAAAATACGATTGGAATCACTTGATATTCAGGGAATTAGCT
TGGTTCGAAGTTGAAATTATCTTGCTCCACCCCAGAAACCCTCACGTTGGAACAACTGACACCCCCTCCCCAATC
CGAGGCAATCCGATGGATGGTCCAGCGGAGACTGCGCATGGACCTATGCTTATCGGCACCCTGCTCAATGTTCTT
CTATTCGGTGTCATGATCGCCCAGGTCTATATCTATTATACAAGTTATCGACGTGACAGACTCGTTCTGAAACTC
TTCGTTTTTGCAGTTTTCCTAGCTGACACCGTAAATTCTGTACTCGACGTTGTATATATTTACATGTGTCTAATT
GTTCATTTCGGAGACCTCGAATACTTAAAGTTCACAAATTGGCAATTCTCCTCAGCCCCCGTGTTGACGGGTATT
ATCGCTTTGATGGTCCAGCTTTTTTTCGCGTGGAGAATCCAATTGTTGACGAGAAATTGGTTTCTGGTGGCTGTC
GTTTCCATGCTTTCTCTTGCATCTGCAATATGTGCCACCATTATAACCTGGTTTGTTACCGTCGTTCCACAGTTC
GATAGATTTCAAGAGTTCCAGGGCGTCGTAATTGGCTGGTTGTCCTGTGCAGCCGCTGCGGATATCCTGATCACT
ACAATTCTTCGGATGCATAAGACCGGCTTCAAAAAATCAGACATCGTTATCGATCGCATCATTCGCATGACCGTG
CAAACTGGCCTTGTTACTTCCGTGGTAGCTATAATCGATCTATCACTTTATCTCGGTATTCCCACTTCTGGAATA
CACTTGCTATTCAATTTCACCCTGTGCAAGCTCTATTCAAATTCTCTCATGAGTAGTCTCAATGCCCGAAGTCGT
TTGAGGCACGGGTCGCAGGGCCAAACAACTCTGGAAAACATGTTCGGAGAGGAGCCTGGACAATCTATTAGTCAT
GGTAATCCGATAGGTGGCTGGCGAGAGCATAATGTTGACATGTTGCGAGCAGGGGAGAAGCCGCAAGCTATTCAA
CTTGATTCTATGGGTCATCCAAAATCGGGGGTGTTTGTCCATGTGGAGTCCCACGAGATGCGAGATATACAGTCG
CATGGGAATGATAATAAATCATGA
Transcript >AgabiH39|095720
ATGACAGGTCCCGAGAAAAAAGAGTATACTTACGGAAAATACGATTGGAATCACTTGATATTCAGGGAATTAGCT
TGGTTCGAAGTTGAAATTATCTTGCTCCACCCCAGAAACCCTCACGTTGGAACAACTGACACCCCCTCCCCAATC
CGAGGCAATCCGATGGATGGTCCAGCGGAGACTGCGCATGGACCTATGCTTATCGGCACCCTGCTCAATGTTCTT
CTATTCGGTGTCATGATCGCCCAGGTCTATATCTATTATACAAGTTATCGACGTGACAGACTCGTTCTGAAACTC
TTCGTTTTTGCAGTTTTCCTAGCTGACACCGTAAATTCTGTACTCGACGTTGTATATATTTACATGTGTCTAATT
GTTCATTTCGGAGACCTCGAATACTTAAAGTTCACAAATTGGCAATTCTCCTCAGCCCCCGTGTTGACGGGTATT
ATCGCTTTGATGGTCCAGCTTTTTTTCGCGTGGAGAATCCAATTGTTGACGAGAAATTGGTTTCTGGTGGCTGTC
GTTTCCATGCTTTCTCTTGCATCTGCAATATGTGCCACCATTATAACCTGGTTTGTTACCGTCGTTCCACAGTTC
GATAGATTTCAAGAGTTCCAGGGCGTCGTAATTGGCTGGTTGTCCTGTGCAGCCGCTGCGGATATCCTGATCACT
ACAATTCTTCGGATGCATAAGACCGGCTTCAAAAAATCAGACATCGTTATCGATCGCATCATTCGCATGACCGTG
CAAACTGGCCTTGTTACTTCCGTGGTAGCTATAATCGATCTATCACTTTATCTCGGTATTCCCACTTCTGGAATA
CACTTGCTATTCAATTTCACCCTGTGCAAGCTCTATTCAAATTCTCTCATGAGTAGTCTCAATGCCCGAAGTCGT
TTGAGGCACGGGTCGCAGGGCCAAACAACTCTGGAAAACATGTTCGGAGAGGAGCCTGGACAATCTATTAGTCAT
GGTAATCCGATAGGTGGCTGGCGAGAGCATAATGTTGACATGTTGCGAGCAGGGGAGAAGCCGCAAGCTATTCAA
CTTGATTCTATGGGTCATCCAAAATCGGGGGTGTTTGTCCATGTGGAGTCCCACGAGATGCGAGATATACAGTCG
CATGGGAATGATAATAAATCATGA
Gene >AgabiH39|095720
ATGACAGGTCCCGAGAAAAAAGAGTATACTTACGGAAAATACGGTGAGAGCCATCTTCCCATAACCCAGATATGT
CTGACGAAACCCAGATTGGAATCACTTGATATTCAGGGAATTAGCTTGGTTCGAAGTTGAAATTATCTTGCTCCA
CCCCAGAAGTCAGCTTTCGGCAACACAGCAATCAAATATAAAGGGATACGAGACCCTCACGTTGGAACAACTGAC
ACCCCCTCCCCAATCCGAGGCAATCCGATGGATGGTCCAGCGGAGACTGCGTACGTTTGTCCATATCCTCACATG
CGGAGCATATCGAATCAGCAAAACCAATAGGCATGGACCTATGCTTATCGGCACCCTGCTCAATGTTCTTCTATT
CGGTGTCATGATCGCCCAGGTCTATATCTATTATACAAGTTATCGACGGCGAGTAGAGATGTTTAACCATTGATG
CTGCCCATAATCATATTTCTTACAGTGACAGACTCGTTCTGAAACTCTTCGTATGTCGTTATGTTCTAATGTCAC
CCTGAACGACTCAACTCGTGTCGCTCAGGTTTTTGCAGTTTTCCTAGCTGACACCGTAAATTCTGTACTCGACGT
TGTATATATTTACATGTGTCTAATTGTTCATTTCGGTAAGTCCCTTTTAATATTCATGCAAAGTTCCATCGCTCA
CTGAGTGTAATATATCGCAGGAGACCTCGAATACTTAAAGTTCACAAATTGGCGTACGTGTTTGCGTTCCGTGGC
CGGTTATCAATCCTTTATCTCACTTTCACCCTATAGAATTCTCCTCAGGTGATGGCGAAAGATTTTGAAAGGAAG
AAATTTTACTGAATTATATACGCCGAAATGTAGCCCCCGTGTTGACGGTAAGCCTGACATAGGAGGCAGGAAGGC
TCACAATGTTTACGTTTTGATACCAAGGGTATTATCGCTTTGATGGTCCAGCTTTTTTTCGCGTGGAGAATCCAA
TTGTTGACGAGAAATTGGTTTCTGGTGGCTGTCGTTTCCATGCTTTCTCTTGCATCTGCAAGTACGTCTCATCAA
GCGACTATAAGAGCTTTCCACTCACATTTCCGGTTTGATCGAAGTATGTGCCACCATTATAACCTGGTTTGTTAC
CGTCGTTCCACAGTTCGATAGATTTCAAGAGTTCCAGGTGGGCAAATAACTACTCTTGACCCAAGTTTTTAATTG
CAGTATTACAAAATAAGGGCGTCGTAATTGGCTGGTTGTCCTGTGCAGCCGCTGCGGATATCCTGATCACTACAA
TTCTTGTGTGGCACTTGTGAGTAGCTCGTCAACATCTGGAATAATGTCTCGCTAATTTCCTCGCTAGGGTAAGGT
GGCCTGGATTTCTATTAAGCTACAACGGCTCAATTATATCTAGCGGATGCATAAGACCGGCTTCAAAAAATCAGA
CATCGTTATCGATCGCATCATTCGCAGTGCGTGAACTTGGAAATTCAAGTAATTTGGCATCTTAAAATGAAACTT
GTCTAGTGACCGTGCAAACTGGCCTTGTTACTTCCGTGGTAGCTATAATCGATCTATCACTTTATCTCGGTATTC
CCGTAAGTGTATCTGCTTCCCTACGTGTCTAGGCTGATCTATTTAATCTCGGCTCTCAAAGACTTCTGGAATGTG
AGTTTCGTACATCGATAAACTTTGAATTCAGGTGATTAAGCATTCGTTGGATTGACAGACACTTGCTATTCAATT
TCACCCTGTGCAAGCTCTATTCAAATTCTCTCATGAGTAGTCTCAATGCCCGAAGTCGTTTGAGGCACGGGTCGC
AGGGCCAAACAACTCTGGAAAACATGTTCGGAGAGGAGCCTGGACAATCTATTAGTCATGGTAATCCGATAGGTG
GCTGGCGAGAGCATAATGTTGACATGTTGCGAGCAGGGGAGAAGGTACAAATCTTTGCTTTTAACAATACGTGTA
CCGTTCGCTAATAGTTTCTTGTATTAGCCGCAAGCTATTCAACTTGATTCTATGGGTCATCCAAAATCGGGGGTG
TTTGTCCATGTGGAGTCCCACGAGATGCGAGATATACAGTCGCATGGGAATGATAATAAATCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail