Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|091850
Gene name
Locationscaffold_06a:1087120..1088999
Strand+
Gene length (bp)1879
Transcript length (bp)1548
Coding sequence length (bp)1548
Protein length (aa) 516

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19270 FBO_C F-box only protein C-terminal region 1.3E-16 298 362
PF12937 F-box-like F-box-like 9.3E-07 235 279
PF00646 F-box F-box domain 1.0E-06 234 275

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74531|POF7_SCHPO F-box protein pof7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof7 PE=1 SV=2 96 358 1.0E-16
sp|Q6P3K3|FBX9_DANRE F-box only protein 9 OS=Danio rerio GN=fbxo9 PE=2 SV=1 226 515 3.0E-15
sp|Q9UK97|FBX9_HUMAN F-box only protein 9 OS=Homo sapiens GN=FBXO9 PE=1 SV=1 224 515 1.0E-14
sp|Q3ZBT2|FBX9_BOVIN F-box only protein 9 OS=Bos taurus GN=FBXO9 PE=2 SV=2 224 395 1.0E-14
sp|Q9XI00|SKI32_ARATH F-box protein 7 OS=Arabidopsis thaliana GN=SKIP32 PE=1 SV=1 232 358 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74531|POF7_SCHPO F-box protein pof7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof7 PE=1 SV=2 96 358 1.0E-16
sp|Q6P3K3|FBX9_DANRE F-box only protein 9 OS=Danio rerio GN=fbxo9 PE=2 SV=1 226 515 3.0E-15
sp|Q9UK97|FBX9_HUMAN F-box only protein 9 OS=Homo sapiens GN=FBXO9 PE=1 SV=1 224 515 1.0E-14
sp|Q3ZBT2|FBX9_BOVIN F-box only protein 9 OS=Bos taurus GN=FBXO9 PE=2 SV=2 224 395 1.0E-14
sp|Q9XI00|SKI32_ARATH F-box protein 7 OS=Arabidopsis thaliana GN=SKIP32 PE=1 SV=1 232 358 2.0E-14
sp|Q5U2X1|FBX9_RAT F-box only protein 9 OS=Rattus norvegicus GN=Fbxo9 PE=1 SV=1 224 515 2.0E-14
sp|Q8BK06|FBX9_MOUSE F-box only protein 9 OS=Mus musculus GN=Fbxo9 PE=1 SV=1 224 515 2.0E-14
sp|Q12347|HRT3_YEAST F-box protein HRT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRT3 PE=1 SV=1 90 365 2.0E-13
sp|F6Y9J3|FBX9_XENTR F-box only protein 9 OS=Xenopus tropicalis GN=fbxo9 PE=3 SV=1 210 395 2.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup4677
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|091850 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|091850
Rhodonia placenta FPRL280 RhoplFPRL280|127_19

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|091850
MANGKAKATELSPEEESPELARFREEWKAELERRKQATRTSLQTPSSSTTRPREVPHIFPARSTKETHGSSTPFD
GHHPAITPDGEILDQKRPKALSSALGVYRQAVLHEQAGDLDSALMCYRQAFRTDPHVDRAYRREEMLKNMVYEQQ
IVKKDPSTPSTTTTASTNSVMTRSPGAITEMTDEITETMRLLSIKSQTQAIVTGTFGALVASFLDQEPGRLAFKP
EDETQPVIFNNLPEEILVEIIHLLDPTSIERFAQVSKKARIVTLESSIWRSLVVSTYKEPQIPDLDVLADIVSRY
MFDYRRIYIEQPRVRLDGVYIAICHYVRPGLSENHWVNMNHLITYHRYLRFYPNGQVLSLLANEEHPPQTIINIL
KPSLRMKGLCIGIWELTGTTVTLSNLSDASGRFIIPEELGTETESGTSTSKGIEIPPPPSAITHPASQHRPSHHL
HSQTELQPSRYVFSMSLSLRSRPLGRWNRLDIQSYDTLNIETGDVTPVALKHERSFWFSRVRSYT*
Coding >AgabiH39|091850
ATGGCCAACGGCAAGGCCAAAGCCACCGAGCTCTCGCCAGAGGAAGAGTCTCCAGAACTCGCAAGATTCAGAGAG
GAATGGAAGGCTGAATTAGAGAGACGCAAACAAGCTACTCGGACTTCTTTGCAAACGCCCTCATCCTCTACAACT
CGACCGAGAGAAGTCCCTCATATATTTCCTGCGCGCAGTACCAAGGAAACCCATGGTTCTTCTACTCCATTCGAT
GGTCATCATCCGGCTATCACTCCCGACGGAGAGATACTTGACCAGAAACGTCCGAAGGCTTTATCGAGTGCACTC
GGTGTCTATCGACAGGCAGTTCTTCACGAACAGGCTGGAGATCTAGACAGTGCTTTAATGTGCTATAGACAAGCT
TTTCGTACGGATCCTCACGTCGATCGTGCATACCGTCGCGAGGAAATGTTGAAGAACATGGTATACGAACAACAA
ATTGTAAAGAAGGATCCCTCCACCCCATCTACAACCACCACCGCCTCTACTAACTCGGTTATGACTCGATCACCG
GGCGCCATAACCGAAATGACAGATGAGATTACAGAAACCATGAGGTTGTTGTCTATTAAATCCCAAACGCAAGCC
ATCGTAACCGGTACATTTGGTGCGCTCGTCGCGTCATTCCTGGATCAAGAACCAGGCAGACTCGCATTCAAACCT
GAAGATGAAACTCAACCAGTCATTTTTAACAATCTTCCTGAGGAAATTCTCGTCGAGATAATTCATCTCTTGGAT
CCTACCTCTATTGAAAGATTTGCGCAAGTCTCCAAGAAGGCCAGAATCGTAACACTGGAATCTTCTATCTGGCGG
AGTTTGGTTGTTTCGACGTATAAGGAACCTCAGATACCTGACTTGGACGTGTTGGCTGATATTGTTTCGCGGTAT
ATGTTTGACTATCGACGGATATATATTGAACAACCTCGCGTGAGGCTCGATGGTGTATATATTGCCATATGCCAC
TACGTACGACCAGGTTTAAGTGAAAACCACTGGGTAAACATGAACCATTTGATTACCTATCACCGTTACCTTCGC
TTTTACCCTAATGGCCAGGTCCTTTCTTTGCTCGCAAACGAGGAACATCCACCACAAACGATAATCAACATTCTC
AAACCGTCCCTCAGAATGAAGGGTTTATGCATCGGGATTTGGGAACTCACTGGAACGACTGTAACACTATCAAAC
CTCTCCGACGCCAGTGGTCGATTTATAATTCCAGAAGAATTAGGAACCGAAACTGAATCTGGAACTTCGACTAGT
AAAGGAATTGAAATACCACCACCACCATCTGCTATAACTCATCCAGCATCGCAACATCGTCCCAGTCATCATCTT
CACTCACAAACTGAACTACAGCCCTCTCGATATGTTTTCTCCATGTCACTTTCTCTACGGTCTCGACCCTTGGGA
AGATGGAATAGGCTGGATATACAATCGTATGATACTCTCAATATTGAAACTGGTGATGTTACCCCTGTGGCACTT
AAACATGAGAGATCGTTTTGGTTCTCGAGGGTTAGGTCTTATACATGA
Transcript >AgabiH39|091850
ATGGCCAACGGCAAGGCCAAAGCCACCGAGCTCTCGCCAGAGGAAGAGTCTCCAGAACTCGCAAGATTCAGAGAG
GAATGGAAGGCTGAATTAGAGAGACGCAAACAAGCTACTCGGACTTCTTTGCAAACGCCCTCATCCTCTACAACT
CGACCGAGAGAAGTCCCTCATATATTTCCTGCGCGCAGTACCAAGGAAACCCATGGTTCTTCTACTCCATTCGAT
GGTCATCATCCGGCTATCACTCCCGACGGAGAGATACTTGACCAGAAACGTCCGAAGGCTTTATCGAGTGCACTC
GGTGTCTATCGACAGGCAGTTCTTCACGAACAGGCTGGAGATCTAGACAGTGCTTTAATGTGCTATAGACAAGCT
TTTCGTACGGATCCTCACGTCGATCGTGCATACCGTCGCGAGGAAATGTTGAAGAACATGGTATACGAACAACAA
ATTGTAAAGAAGGATCCCTCCACCCCATCTACAACCACCACCGCCTCTACTAACTCGGTTATGACTCGATCACCG
GGCGCCATAACCGAAATGACAGATGAGATTACAGAAACCATGAGGTTGTTGTCTATTAAATCCCAAACGCAAGCC
ATCGTAACCGGTACATTTGGTGCGCTCGTCGCGTCATTCCTGGATCAAGAACCAGGCAGACTCGCATTCAAACCT
GAAGATGAAACTCAACCAGTCATTTTTAACAATCTTCCTGAGGAAATTCTCGTCGAGATAATTCATCTCTTGGAT
CCTACCTCTATTGAAAGATTTGCGCAAGTCTCCAAGAAGGCCAGAATCGTAACACTGGAATCTTCTATCTGGCGG
AGTTTGGTTGTTTCGACGTATAAGGAACCTCAGATACCTGACTTGGACGTGTTGGCTGATATTGTTTCGCGGTAT
ATGTTTGACTATCGACGGATATATATTGAACAACCTCGCGTGAGGCTCGATGGTGTATATATTGCCATATGCCAC
TACGTACGACCAGGTTTAAGTGAAAACCACTGGGTAAACATGAACCATTTGATTACCTATCACCGTTACCTTCGC
TTTTACCCTAATGGCCAGGTCCTTTCTTTGCTCGCAAACGAGGAACATCCACCACAAACGATAATCAACATTCTC
AAACCGTCCCTCAGAATGAAGGGTTTATGCATCGGGATTTGGGAACTCACTGGAACGACTGTAACACTATCAAAC
CTCTCCGACGCCAGTGGTCGATTTATAATTCCAGAAGAATTAGGAACCGAAACTGAATCTGGAACTTCGACTAGT
AAAGGAATTGAAATACCACCACCACCATCTGCTATAACTCATCCAGCATCGCAACATCGTCCCAGTCATCATCTT
CACTCACAAACTGAACTACAGCCCTCTCGATATGTTTTCTCCATGTCACTTTCTCTACGGTCTCGACCCTTGGGA
AGATGGAATAGGCTGGATATACAATCGTATGATACTCTCAATATTGAAACTGGTGATGTTACCCCTGTGGCACTT
AAACATGAGAGATCGTTTTGGTTCTCGAGGGTTAGGTCTTATACATGA
Gene >AgabiH39|091850
ATGGCCAACGGCAAGGCCAAAGCCACCGAGCTCTCGCCAGAGGAAGAGTCTCCAGAACTCGCAAGATTCAGAGAG
GAATGGAAGGCTGAATTAGAGAGACGCAAACAAGCTACTCGGACTTCTTTGCAAACGCCCTCATCCTCTACAACT
CGACCGAGAGAAGTCCCTCATATATTTCCTGCGCGCAGTACCAAGGAAACCCATGGTTCTTCTACTCCATTCGAT
GGTCATCATCCGGCTATCACTCCCGACGGAGAGATACTTGACCAGAAACGTCCGAAGGCTTTATCGAGTGCACTC
GGTGTCTATCGACAGGCAGTTCTTCACGAACAGGCTGGAGATCTAGACAGTGCTTTAATGTGCTATAGACAAGCT
TTTCGTACGGTACGTCGTTTCTACCATTTTATCGCTTATTCCTCACCAGTGACTTAGGAGCTCAACAGGATCCTC
ACGTCGATCGTGCATACCGTCGCGAGGAAATGTTGAAGAACATGGTATACGAACAACAAATTGTAAAGAAGGATC
CCTCCACCCCATCTACAACCACCACCGCCTCTACTAACTCGGTTATGACTCGATCACCGGGCGCCATAACCGAAA
TGACAGATGAGATTACAGAAACCATGAGGTTGTTGTCTATTAAATCCCAAACGCAAGCCATCGTAACCGGTACAT
TTGGTGCGCTCGTCGCGTCATTCCTGGATCAAGAACCAGGCAGACTCGCATTCAAACCTGAAGATGAAACTCAAC
CAGTCATTTTTAACAATCTTCCTGAGGAAATTCTCGTCGAGATAATTCATCTCTTGGATCCTACCTCTATTGAAA
GATTTGCGCAAGTCTCCAAGAAGGCCAGAATCGTAACACTGGAATCTTCTATCTGGCGGTACGTTGTAATAATTA
ACGAGCTATATATAGCTTCTAACTTGCGACCATATTAGGAGTTTGGTTGTTTCGACGTATAAGGAACCTCAGATA
CCTGACTTGGACGTGTTGGCTGATATTGTTTCGCGGTATATGTTTGACTATCGACGGATATATATTGAACAACCT
CGCGTGAGGCTCGATGGTGTATATATTGCCATATGCCACTACGTGTGAGCACTTCACCTCGGTCTCTTTTGCGTG
GCCTAATCTTTTTCTGTTCCACAGACGACCAGGTTTAAGTGAAAACCACTGGGTAAACGTATGTCAGTATGCGTT
AAAAGTTTTCCCTTTCGTCTGAGAGTCTGCATAGATGAACCATTTGATTACCTATCACCGTTACCTGTAAGTCGT
CGTCATCCTCTTTATCTCGCGTTTACTAAGCCTTTTGTAATTTTCAGTCGCTTTTACCCTAATGGCCAGGTCCTT
TCTTTGCTCGCAAACGAGGAACATCCACCACAAACGATAATCAACATTCTCAAACCGTCCCTCAGAATGAAGGTG
AGTCAATCACTAATGCCAAAGGTCTCGTCTTATCCTCTGATAACTCCAAAAGGGTTTATGCATCGGGATTTGGGA
ACTCACTGGAACGACTGTAACACTATCAAACCTCTCCGACGCCAGTGGTCGATTTATAATTCCAGAAGAATTAGG
AACCGAAACTGAATCTGGAACTTCGACTAGTAAAGGAATTGAAATACCACCACCACCATCTGCTATAACTCATCC
AGCATCGCAACATCGTCCCAGTCATCATCTTCACTCACAAACTGAACTACAGCCCTCTCGATATGTTTTCTCCAT
GTCACTTTCTCTACGGTCTCGACCCTTGGGAAGATGGAATAGGCTGGATATACAATCGTATGATACTCTCAATAT
TGAAACTGGTGATGTTACCCCTGTGGCACTTAAACATGAGAGATCGTTTTGGTTCTCGAGGGTTAGGTCTTATAC
ATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail