Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|083660
Gene name
Locationscaffold_05:1368430..1369659
Strand+
Gene length (bp)1229
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5M501|IR222_CANTT Increased recombination centers protein 22-2 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=IRC22-2 PE=3 SV=1 52 227 3.0E-12
sp|B9WCP3|IRC22_CANDC Increased recombination centers protein 22 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=IRC22 PE=3 SV=1 5 230 3.0E-10
sp|C4R0M5|IRC22_PICPG Increased recombination centers protein 22 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=IRC22 PE=3 SV=1 44 182 2.0E-08
sp|C5M580|IR221_CANTT Increased recombination centers protein 22-1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=IRC22-1 PE=3 SV=1 52 227 4.0E-08
sp|Q6BW93|IRC22_DEBHA Increased recombination centers protein 22 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IRC22 PE=3 SV=1 50 229 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5M501|IR222_CANTT Increased recombination centers protein 22-2 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=IRC22-2 PE=3 SV=1 52 227 3.0E-12
sp|B9WCP3|IRC22_CANDC Increased recombination centers protein 22 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=IRC22 PE=3 SV=1 5 230 3.0E-10
sp|C4R0M5|IRC22_PICPG Increased recombination centers protein 22 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=IRC22 PE=3 SV=1 44 182 2.0E-08
sp|C5M580|IR221_CANTT Increased recombination centers protein 22-1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=IRC22-1 PE=3 SV=1 52 227 4.0E-08
sp|Q6BW93|IRC22_DEBHA Increased recombination centers protein 22 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IRC22 PE=3 SV=1 50 229 1.0E-07
sp|A3LU17|IRC22_PICST Increased recombination centers protein 22 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=IRC22 PE=3 SV=1 1 232 1.0E-07
sp|Q59XW9|IR222_CANAL Increased recombination centers protein 22-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IRC22-2 PE=3 SV=1 5 230 3.0E-07
sp|C4YKP5|IR221_CANAW Increased recombination centers protein 22-1 OS=Candida albicans (strain WO-1) GN=IRC22-1 PE=3 SV=1 5 230 4.0E-07
sp|P0CH79|IR222_CANAW Increased recombination centers protein 22-2 OS=Candida albicans (strain WO-1) GN=IRC22-2 PE=3 SV=1 5 230 4.0E-07
sp|Q59YF4|IR221_CANAL Increased recombination centers protein 22-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IRC22-1 PE=3 SV=1 5 230 4.0E-07
sp|A5DYV2|IRC22_LODEL Increased recombination centers protein 22 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=IRC22 PE=3 SV=1 46 230 5.0E-07
sp|C5DJ31|IRC22_LACTC Increased recombination centers protein 22 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=IRC22 PE=3 SV=1 48 224 1.0E-06
sp|A5DEU9|IRC22_PICGU Increased recombination centers protein 22 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=IRC22 PE=3 SV=1 50 230 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999657

Transmembrane Domains

Domain # Start End Length
1 161 183 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup6098
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|083660 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|083660

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|083660
MRFARLSSTILSLAILATSVAAVEVIQNVEITEPEVVATAAFAESNPFHQIVNGEKNTLTLSVENKSDRNVTLVA
IAGSLHHPDTDVLIKNLTSLNYNMPLIENFNINLPYMFYSEFKPGEARLNVWLEHAVEDQKYRVQVYDSIVTIVE
PEISWLDWKMWSTYLVVAGLLGGLSYFAYMTFVPQPKKRSKKAAPVVSAPVGTVTATGSGGYQEEWIPEHHLRKG
KKTKQTGGVTSGTSADEMSGADASGTEGKKRKGRK*
Coding >AgabiH39|083660
ATGCGTTTCGCCCGTCTATCTTCAACAATCCTCTCCTTAGCTATTCTCGCAACCTCCGTTGCTGCCGTTGAAGTC
ATACAAAATGTCGAAATCACCGAACCCGAAGTAGTCGCAACAGCAGCTTTTGCGGAGTCTAACCCTTTCCACCAA
ATCGTCAACGGAGAGAAAAACACCCTGACTCTATCAGTGGAGAACAAGTCGGACCGGAATGTAACACTGGTTGCC
ATTGCTGGATCCCTACACCACCCGGATACAGATGTGCTCATAAAAAACTTGACATCACTCAATTATAATATGCCT
CTAATTGAAAACTTCAACATCAACCTTCCCTACATGTTCTATAGCGAATTCAAGCCAGGTGAAGCCCGTTTGAAC
GTGTGGTTAGAACACGCTGTCGAGGACCAAAAATATCGCGTTCAGGTATATGATTCTATCGTGACTATTGTCGAA
CCGGAAATTTCTTGGCTGGATTGGAAGATGTGGTCGACTTATTTGGTTGTCGCGGGTCTGCTCGGTGGTCTTTCA
TATTTCGCCTACATGACCTTTGTCCCGCAACCCAAGAAGCGTAGCAAAAAAGCAGCACCAGTTGTCAGCGCTCCT
GTCGGCACGGTCACCGCTACCGGTTCTGGTGGCTATCAAGAGGAATGGATCCCTGAACACCACCTCCGCAAAGGC
AAGAAGACCAAACAGACTGGTGGTGTTACTTCCGGAACTAGCGCAGATGAAATGAGTGGTGCTGATGCAAGTGGT
ACCGAGGGTAAGAAGAGGAAGGGGCGCAAGTGA
Transcript >AgabiH39|083660
ATGCGTTTCGCCCGTCTATCTTCAACAATCCTCTCCTTAGCTATTCTCGCAACCTCCGTTGCTGCCGTTGAAGTC
ATACAAAATGTCGAAATCACCGAACCCGAAGTAGTCGCAACAGCAGCTTTTGCGGAGTCTAACCCTTTCCACCAA
ATCGTCAACGGAGAGAAAAACACCCTGACTCTATCAGTGGAGAACAAGTCGGACCGGAATGTAACACTGGTTGCC
ATTGCTGGATCCCTACACCACCCGGATACAGATGTGCTCATAAAAAACTTGACATCACTCAATTATAATATGCCT
CTAATTGAAAACTTCAACATCAACCTTCCCTACATGTTCTATAGCGAATTCAAGCCAGGTGAAGCCCGTTTGAAC
GTGTGGTTAGAACACGCTGTCGAGGACCAAAAATATCGCGTTCAGGTATATGATTCTATCGTGACTATTGTCGAA
CCGGAAATTTCTTGGCTGGATTGGAAGATGTGGTCGACTTATTTGGTTGTCGCGGGTCTGCTCGGTGGTCTTTCA
TATTTCGCCTACATGACCTTTGTCCCGCAACCCAAGAAGCGTAGCAAAAAAGCAGCACCAGTTGTCAGCGCTCCT
GTCGGCACGGTCACCGCTACCGGTTCTGGTGGCTATCAAGAGGAATGGATCCCTGAACACCACCTCCGCAAAGGC
AAGAAGACCAAACAGACTGGTGGTGTTACTTCCGGAACTAGCGCAGATGAAATGAGTGGTGCTGATGCAAGTGGT
ACCGAGGGTAAGAAGAGGAAGGGGCGCAAGTGA
Gene >AgabiH39|083660
ATGCGTTTCGCCCGTCTATCTTCAACAATCCTCTCCTTAGCTATTCTCGCAACCTCCGTTGCTGCCGGTAGGGTT
TAATGTGCTCAGAATTTTGCCTTCTTAGTCACTCATTGGTCATCCATCTAGTTGAAGTCATACAAAATGTCGAAA
TCACCGAACCCGAAGTAGTCGCAACAGCAGCTTTTGCGGAGTCTAACCCTTTCCACCGTGCGTTTTTTGTATCCA
GTCATAACTGTGTTACACAGTCTCGCTAACTTTTATTTCCTGACTCGTCGGTCCATCTCCGACGCGTATAGAAAT
CGTCAACGGAGAGAAAAACACCCTGACTCTATCAGTGGAGAACAAGTCGGACCGGAATGTAACACTGGTTGCCAT
TGCTGGATCCCTACACCACCCGGATACAGATGTGCTCATAAAAAACGTGGGTACTTTCTTTCAACGTCGGTGTAT
GTTGTTGAATGGCTAATTGGGTATTGTTACCAGTTGACATCACTCAATTATAATATGCCTCTAATTGAAAACTTC
AACATCAACCTTCCCTACATGTTCTATAGCGAGTGAGCAATCCCCGAGGACATAATTCATCACTGCATACCGATA
CTGACCATCTTGATTTTAAAGATTCAAGGTATCTCATTTCATTAAGTTTGTCTCGTGAAACAGTGATTTGATCCA
GGAATATCCGATCAGCCAGGTGAAGCCCGTTTGAACGTGTGGTTAGAACACGCTGTCGAGGTTTGATGACCGTAT
CTCAAACTTATGGTTATGCGCTTACAGTTCCGAAACTTAGGACCAAAAATATCGCGTTCAGGTATATGATTCTAT
CGTGACTATTGTCGAACCGGAAATTTCTTGGCTGGATTGGAAGATGTATGGTTTATCCAACGTATATTTCGACAT
TGGCCCTAATTAGATGTCATTCTAGGTGGTCGACTTATTTGGTTGTCGCGGGTCTGCTCGGTGGTCTTTCATATT
TCGCCTACATGACCTTTGTCCCGCAACCCAAGAAGCGTAGCAAAAAAGCAGCACCAGTTGTCAGCGCTCCTGTCG
GCACGGTCACCGCTACCGGTTCTGGTGGCTATCAAGAGGAATGGATCCCTGAACACCACCTCCGCAAAGGCAAGA
AGACCAAACAGACTGGTGGTGTTACTTCCGGAACTAGCGCAGATGAAATGAGTGGTGCTGATGCAAGTGGTACCG
AGGGTAAGAAGAGGAAGGGGCGCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail