Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|082250
Gene name
Locationscaffold_05:1022602..1023115
Strand-
Gene length (bp)513
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup12668
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|082250 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|082250

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|082250
MLAIVQGSDNSAWELSGSAAPPPASTDPNELRAQALLLARASAIIKSHLPNLMLSQAATQMGARALWSWLEGQYG
QKRPMFAYEHFVTAQSFKINDSTDPSSAIADLYALFATVESTGATIHELIHTMMLLGNVLPLVIPLSPTTGPKQK
YYPSGISVLIVMIVEQIRVF*
Coding >AgabiH39|082250
ATGCTAGCTATAGTCCAAGGCTCCGATAATTCAGCTTGGGAGTTGAGCGGCTCTGCAGCTCCTCCTCCAGCGTCC
ACAGACCCTAATGAATTAAGGGCTCAAGCTCTTCTCTTGGCCCGAGCATCTGCAATTATCAAGTCACACCTTCCA
AATTTGATGCTTAGCCAAGCCGCCACCCAGATGGGCGCTAGAGCTCTTTGGAGCTGGTTGGAAGGCCAGTATGGC
CAAAAAAGACCAATGTTTGCTTATGAACATTTTGTGACAGCTCAGAGTTTCAAAATTAATGACTCCACCGATCCA
TCGTCTGCAATTGCAGATCTCTATGCCCTATTTGCCACTGTTGAGAGTACTGGTGCGACAATTCATGAATTGATT
CATACTATGATGCTCCTCGGAAATGTCCTTCCCCTCGTGATTCCCCTATCCCCTACAACAGGGCCAAAGCAAAAG
TATTATCCCTCTGGTATCAGTGTCTTAATTGTTATGATTGTGGAACAAATCCGAGTATTCTAA
Transcript >AgabiH39|082250
ATGCTAGCTATAGTCCAAGGCTCCGATAATTCAGCTTGGGAGTTGAGCGGCTCTGCAGCTCCTCCTCCAGCGTCC
ACAGACCCTAATGAATTAAGGGCTCAAGCTCTTCTCTTGGCCCGAGCATCTGCAATTATCAAGTCACACCTTCCA
AATTTGATGCTTAGCCAAGCCGCCACCCAGATGGGCGCTAGAGCTCTTTGGAGCTGGTTGGAAGGCCAGTATGGC
CAAAAAAGACCAATGTTTGCTTATGAACATTTTGTGACAGCTCAGAGTTTCAAAATTAATGACTCCACCGATCCA
TCGTCTGCAATTGCAGATCTCTATGCCCTATTTGCCACTGTTGAGAGTACTGGTGCGACAATTCATGAATTGATT
CATACTATGATGCTCCTCGGAAATGTCCTTCCCCTCGTGATTCCCCTATCCCCTACAACAGGGCCAAAGCAAAAG
TATTATCCCTCTGGTATCAGTGTCTTAATTGTTATGATTGTGGAACAAATCCGAGTATTCTAA
Gene >AgabiH39|082250
ATGCTAGCTATAGTCCAAGGCTCCGATAATTCAGCTTGGGAGTTGAGCGGCTCTGCAGCTCCTCCTCCAGCGTCC
ACAGACCCTAATGAATTAAGGGCTCAAGCTCTTCTCTTGGCCCGAGCATCTGCAATTATCAAGTCACACCTTCCA
AATTTGATGCTTAGCCAAGCCGCCACCCAGATGGGCGCTAGAGCTCTTTGGAGCTGGTTGGAAGGCCAGTATGGC
CAAAAAAGACCAATGTTTGCTTATGAACATTTTGTGACAGCTCAGAGTTTCAAAATTAATGACTCCACCGATCCA
TCGTCTGCAATTGCAGATCTCTATGCCCTATTTGCCACTGTTGAGAGTACTGGTGCGACAATTCATGAATTGATT
CATACTATGATGCTCCTCGGAAATGTCCTTCCCCTCGTGATTCCCCTATCCCCTACAACAGGGCCAAAGCAAAAG
TATTATCCCTCTGGTATCAGTGTCTTAATTGTTATGATTGTGGAACAAATCCGAGTATTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail