Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|080500
Gene name
Locationscaffold_05:570340..571781
Strand-
Gene length (bp)1441
Transcript length (bp)1227
Coding sequence length (bp)1227
Protein length (aa) 409

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 2.3E-50 104 317

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B9W4V6|APO1_AGRAE Aromatic peroxygenase OS=Agrocybe aegerita GN=APO1 PE=1 SV=1 49 408 1.0E-152
sp|B9W4V8|APO1_COPRA Aromatic peroxygenase (Fragments) OS=Coprinellus radians GN=APO PE=1 SV=2 84 316 6.0E-97
sp|Q00668|STCC_EMENI Putative sterigmatocystin biosynthesis peroxidase stcC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcC PE=3 SV=2 106 290 1.0E-17
sp|P04963|PRXC_LEPFU Chloroperoxidase OS=Leptoxyphium fumago GN=CPO PE=1 SV=3 100 254 5.0E-07

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0016491 oxidoreductase activity No
GO:0016209 antioxidant activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup173
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|024140
Agaricus bisporus var bisporus H39 AgabiH39|306500
Agaricus bisporus var bisporus H39 AgabiH39|306300
Agaricus bisporus var bisporus H39 AgabiH39|306000
Agaricus bisporus var bisporus H39 AgabiH39|305800
Agaricus bisporus var bisporus H39 AgabiH39|305600
Agaricus bisporus var bisporus H39 AgabiH39|305100
Agaricus bisporus var bisporus H39 AgabiH39|304500
Agaricus bisporus var bisporus H39 AgabiH39|301800
Agaricus bisporus var bisporus H39 AgabiH39|234900
Agaricus bisporus var bisporus H39 AgabiH39|305300
Agaricus bisporus var bisporus H39 AgabiH39|107580
Agaricus bisporus var bisporus H39 AgabiH39|117180
Agaricus bisporus var bisporus H39 AgabiH39|029320
Agaricus bisporus var bisporus H39 AgabiH39|029390
Agaricus bisporus var bisporus H39 AgabiH39|065210
Agaricus bisporus var bisporus H39 AgabiH39|027140
Agaricus bisporus var bisporus H39 AgabiH39|080500 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|099320
Agaricus bisporus var bisporus H39 AgabiH39|107550
Agaricus bisporus var bisporus H39 AgabiH39|065350
Agaricus bisporus var bisporus H97 AgabiH97|065140
Agaricus bisporus var bisporus H97 AgabiH97|107550
Agaricus bisporus var bisporus H97 AgabiH97|099320
Agaricus bisporus var bisporus H97 AgabiH97|080500
Agaricus bisporus var bisporus H97 AgabiH97|065350
Agaricus bisporus var bisporus H97 AgabiH97|065250
Agaricus bisporus var bisporus H97 AgabiH97|065210
Agaricus bisporus var bisporus H97 AgabiH97|065200
Agaricus bisporus var bisporus H97 AgabiH97|065170
Agaricus bisporus var bisporus H97 AgabiH97|065120
Agaricus bisporus var bisporus H97 AgabiH97|014580
Agaricus bisporus var bisporus H97 AgabiH97|065040
Agaricus bisporus var bisporus H97 AgabiH97|064700
Agaricus bisporus var bisporus H97 AgabiH97|064190
Agaricus bisporus var bisporus H97 AgabiH97|029390
Agaricus bisporus var bisporus H97 AgabiH97|029320
Agaricus bisporus var bisporus H97 AgabiH97|027140
Agaricus bisporus var bisporus H97 AgabiH97|024140
Agaricus bisporus var bisporus H97 AgabiH97|023550
Agaricus bisporus var bisporus H97 AgabiH97|107580
Agaricus bisporus var bisporus H97 AgabiH97|065070
Agaricus bisporus var bisporus H97 AgabiH97|117180

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|080500
MISSLDSLFKATPWFSNANIPPLLLKIPVALLPAKLLMNPFLKLAVLALVTAPLAGAFPSHRSLGGLSSEQLDRI
FPTLKVAPPEGPPPPQDDTSTRLVDDADHPFMPAGPNDMRGPCPGLNTLASHGYLPRNGIATPAQVINATMQGFN
MEFSLAKFVTYAAFLVDGNPITNLMSIGGKSDLTGEDPPDPATVGGLNTHAVFEGDASMTRADAFFGDNHSFNQT
LWDGFVDFSNRFGAGKYNLTVATELRIQRIQDSIATNPQFSFVSPRFITAYAESTFPINFFIDGRQQDGQLDLDA
AISFFRDMRYPSGFFRAPKPMGVEGIETIIAAHPIPAGANNGAVNTYTPDPHSGDFNSFCTVYTNFVNETIRGLY
PSPTGILKDSLNRNLDFLHDFVSGCPQIFPWGR*
Coding >AgabiH39|080500
ATGATTAGCTCGCTAGACAGCTTGTTTAAAGCTACGCCATGGTTCTCAAACGCAAACATCCCCCCGTTACTTCTC
AAGATCCCTGTGGCGCTTCTCCCTGCGAAACTATTGATGAATCCCTTTCTCAAACTTGCTGTGCTAGCCTTGGTA
ACTGCACCATTAGCAGGGGCCTTCCCGTCCCATCGCTCCCTTGGTGGCCTCTCTTCAGAACAATTGGATAGAATT
TTTCCAACGCTCAAGGTAGCTCCTCCGGAAGGTCCTCCGCCGCCTCAGGACGATACGTCGACCAGATTGGTTGAT
GACGCTGATCATCCATTTATGCCGGCGGGTCCGAATGACATGCGTGGGCCTTGCCCTGGACTCAATACCCTTGCA
TCCCACGGGTACCTGCCCCGGAATGGAATTGCAACTCCCGCTCAAGTCATCAATGCTACAATGCAAGGTTTCAAC
ATGGAGTTCTCCCTTGCAAAGTTTGTCACATACGCCGCATTCCTGGTAGATGGCAATCCCATTACCAACTTGATG
AGTATCGGAGGAAAAAGCGACCTCACTGGTGAAGACCCTCCCGACCCTGCAACGGTCGGTGGTTTGAACACACAC
GCTGTATTCGAAGGTGATGCCAGCATGACCCGGGCCGATGCGTTCTTTGGGGATAACCACAGCTTTAATCAAACA
TTGTGGGATGGGTTTGTCGACTTCAGTAACCGATTTGGTGCCGGGAAATACAACCTAACGGTGGCCACTGAACTT
CGGATCCAAAGAATCCAGGACTCAATCGCAACAAACCCACAATTCTCATTCGTTTCTCCCCGTTTCATCACAGCC
TACGCGGAATCTACCTTTCCTATCAACTTTTTCATTGACGGTCGTCAGCAGGACGGTCAGCTCGACCTCGATGCT
GCTATCAGCTTCTTCCGTGATATGAGGTATCCGTCAGGTTTCTTCAGAGCTCCTAAACCAATGGGCGTCGAGGGT
ATCGAGACTATTATAGCTGCTCATCCCATTCCTGCCGGCGCAAACAACGGCGCTGTCAACACCTATACTCCCGAC
CCTCACTCTGGGGATTTCAATTCGTTCTGCACGGTATACACCAACTTCGTCAATGAAACGATTAGAGGTTTATAT
CCTTCGCCGACGGGTATATTGAAAGACAGCTTGAACCGAAACTTGGATTTCCTTCACGATTTTGTATCAGGTTGC
CCACAAATCTTCCCGTGGGGGAGATAA
Transcript >AgabiH39|080500
ATGATTAGCTCGCTAGACAGCTTGTTTAAAGCTACGCCATGGTTCTCAAACGCAAACATCCCCCCGTTACTTCTC
AAGATCCCTGTGGCGCTTCTCCCTGCGAAACTATTGATGAATCCCTTTCTCAAACTTGCTGTGCTAGCCTTGGTA
ACTGCACCATTAGCAGGGGCCTTCCCGTCCCATCGCTCCCTTGGTGGCCTCTCTTCAGAACAATTGGATAGAATT
TTTCCAACGCTCAAGGTAGCTCCTCCGGAAGGTCCTCCGCCGCCTCAGGACGATACGTCGACCAGATTGGTTGAT
GACGCTGATCATCCATTTATGCCGGCGGGTCCGAATGACATGCGTGGGCCTTGCCCTGGACTCAATACCCTTGCA
TCCCACGGGTACCTGCCCCGGAATGGAATTGCAACTCCCGCTCAAGTCATCAATGCTACAATGCAAGGTTTCAAC
ATGGAGTTCTCCCTTGCAAAGTTTGTCACATACGCCGCATTCCTGGTAGATGGCAATCCCATTACCAACTTGATG
AGTATCGGAGGAAAAAGCGACCTCACTGGTGAAGACCCTCCCGACCCTGCAACGGTCGGTGGTTTGAACACACAC
GCTGTATTCGAAGGTGATGCCAGCATGACCCGGGCCGATGCGTTCTTTGGGGATAACCACAGCTTTAATCAAACA
TTGTGGGATGGGTTTGTCGACTTCAGTAACCGATTTGGTGCCGGGAAATACAACCTAACGGTGGCCACTGAACTT
CGGATCCAAAGAATCCAGGACTCAATCGCAACAAACCCACAATTCTCATTCGTTTCTCCCCGTTTCATCACAGCC
TACGCGGAATCTACCTTTCCTATCAACTTTTTCATTGACGGTCGTCAGCAGGACGGTCAGCTCGACCTCGATGCT
GCTATCAGCTTCTTCCGTGATATGAGGTATCCGTCAGGTTTCTTCAGAGCTCCTAAACCAATGGGCGTCGAGGGT
ATCGAGACTATTATAGCTGCTCATCCCATTCCTGCCGGCGCAAACAACGGCGCTGTCAACACCTATACTCCCGAC
CCTCACTCTGGGGATTTCAATTCGTTCTGCACGGTATACACCAACTTCGTCAATGAAACGATTAGAGGTTTATAT
CCTTCGCCGACGGGTATATTGAAAGACAGCTTGAACCGAAACTTGGATTTCCTTCACGATTTTGTATCAGGTTGC
CCACAAATCTTCCCGTGGGGGAGATAA
Gene >AgabiH39|080500
ATGATTAGCTCGCTAGACAGCTTGTTTAAAGCTACGCCATGGTTCTCAAACGCAAACATCCCCCCGTTACTTCTC
AAGATCCCTGTGGCGCTTCTCCCTGCGAAACTATTGATGAATCCCTTTCTCAAACTTGCTGTGCTAGCCTTGGTA
ACTGCACCATTAGCAGGGGCCTTCCCGTCCCATCGCTCCCTTGGTGGCCTCTCTTCAGAACAATTGGATAGAATT
TTTCCAACGCTCAAGGTAGCTCCTCCGGAAGGTCCTCCGCCGCCTCAGGACGATACGTCGACCAGATTGGTTGAT
GACGCTGATCATCCATTTATGCCGGCGGGTCCGAATGACATGCGTGGGCCTTGCCCTGGACTCAATACCCTTGCA
TCCCACGGGGTAATTTATCTCTTCGTCTACTCCCAATGCAAATTCACATCCGTCATGACAGTACCTGCCCCGGAA
TGGAATTGCAACTCCCGCTCAAGTCATCAATGCTACAATGCAAGGCGAGTAATTTACAGTTTTTCCTGGAAATCT
GGTACTAAAAATTTGCAGGTTTCAACATGGAGTTCTCCCTTGCAAAGTTTGTCACATACGCCGCATTCCTGGTAG
ATGGCAATCCCATTACCAACTTGATGAGTATCGGAGGAAAAAGCGACCTCACTGGTGAAGACCCTCCCGACCCTG
CAACGGTCGGTGGTTTGAACACACACGCTGTATTCGAAGGTGCTGTGTCTTTTTGAGGGTCGTGGGTTGTATTTA
ACGATAGGTTCATATAGGTGATGCCAGCATGACCCGGGCCGATGCGTTCTTTGGGGATAACCACAGCTTTAATCA
AACATTGTGGGATGGGGTACGTACGGTCGTTCTTTGATATTCTTCAATTACTCATATGTCCACCTTTCTCTTTCA
GTTTGTCGACTTCAGTAACCGATTTGGTGCCGGGAAATACAACCTAACGGTGGCCACTGAACTTCGGATCCAAAG
AATCCAGGACTCAATCGCAACAAACCCACAATTCTCATTCGTTTCTCCCCGTTTCATCACAGCCTACGCGGAATC
TACCTTTCCTATCAACTTTTTCATTGACGGTCGTCAGCAGGACGGTCAGCTCGACCTCGATGCTGCTATCAGCTT
CTTCCGTGATATGAGGTATCCGTCAGGTTTCTTCAGAGCTCCTAAACCAATGGGCGTCGAGGGTATCGAGACTAT
TATAGCTGCTCATCCCATTCCTGCCGGCGCAAACAACGGCGCTGTCAACACCTATACTCCCGACCCTCACTCTGG
GGATTTCAATTCGTTCTGCACGGTATACACCAACTTCGTCAATGAAACGATTAGAGGTTTATATCCTTCGCCGAC
GGGTATATTGAAAGACAGCTTGAACCGAAACTTGGATTTCCTTCACGATTTTGTATCAGGTTGCCCACAAATCTT
CCCGTGGGGGAGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail