Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|079060
Gene name
Locationscaffold_05:187899..189088
Strand-
Gene length (bp)1189
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00646 F-box F-box domain 1.2E-03 6 41
PF12937 F-box-like F-box-like 2.2E-05 4 43

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup8941
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|079060 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|079060

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|079060
MHHIQALPLELLGLIIESLSHERDALLQASLTCKVWRSICYRHLFSAVILNSRSLPPFFELLENQFTRTTIPLCV
RRLSIDFPAPTATIYFGWRECLTKILMHLSHVDRVAHLKLSNMCTTDGVLSSVLSSAFTNANTLDLSNSTFGDPM
ALGDFLGAYPHLKQVVLRDVLCPIPYSASLSPLPPVGAYGLQISASADFGFHASLKWCRTSEAKNLQQLGAVSFI
HPGNIHHVLNILAPFLNFLELMHPAQNVESQNSLPYEINLHNATHLRFLSLGFPDRVLGVMPWILRILHYLQGSS
LRGLRLSFSASQQFTLDIPFLKLLRQTLEKPQFRRLQSLQFFTFNTFGDEDVAKLVVKHVSESLDSWHEQGKLRF
AFPP*
Coding >AgabiH39|079060
ATGCACCATATTCAGGCGCTTCCACTCGAACTTCTGGGCCTCATTATTGAGTCCTTGTCACACGAGAGGGATGCC
CTCCTTCAGGCCAGCTTGACGTGTAAAGTCTGGCGTTCTATCTGCTACCGCCACTTGTTTTCAGCTGTCATTTTG
AACTCGCGGTCTTTACCGCCTTTCTTTGAGCTCTTGGAGAATCAATTCACACGTACTACTATCCCTTTATGCGTT
CGCCGATTGTCCATCGACTTCCCAGCCCCAACCGCCACTATATACTTTGGTTGGCGCGAGTGCTTGACCAAAATA
CTGATGCACTTGTCCCATGTCGATCGCGTTGCGCATCTCAAACTTTCGAATATGTGTACAACAGACGGCGTACTG
TCCTCTGTGCTGTCTTCTGCTTTTACCAATGCCAACACGCTCGACCTTTCCAATTCTACCTTCGGTGATCCTATG
GCACTAGGAGACTTCCTCGGTGCTTATCCTCACCTCAAACAAGTCGTATTGAGGGATGTTCTCTGCCCAATCCCT
TACTCAGCGTCCCTCTCCCCTCTACCCCCGGTAGGCGCTTATGGACTACAAATCTCGGCGTCCGCTGATTTCGGG
TTCCATGCGAGCCTAAAATGGTGTCGAACCTCAGAGGCTAAGAACTTACAACAATTGGGTGCTGTATCTTTCATA
CACCCGGGCAACATTCATCACGTATTGAATATCCTTGCTCCTTTCTTAAACTTCTTGGAGCTAATGCACCCAGCA
CAAAATGTGGAATCGCAAAACTCCCTCCCGTATGAAATAAATCTCCATAATGCTACACATCTTCGTTTCCTTAGT
CTGGGCTTCCCAGATCGTGTCCTCGGTGTCATGCCATGGATCCTTCGCATATTACATTATCTTCAAGGAAGTTCG
CTACGTGGGTTACGGTTATCTTTTTCCGCTTCCCAACAATTCACCCTCGACATACCCTTTCTCAAACTCCTCCGC
CAAACATTGGAAAAGCCTCAGTTCCGAAGGTTGCAAAGTCTCCAGTTCTTCACCTTCAACACGTTCGGCGATGAA
GATGTTGCCAAACTTGTTGTCAAGCACGTGAGCGAGTCGCTGGACAGTTGGCACGAGCAAGGCAAATTGAGATTT
GCCTTTCCGCCATGA
Transcript >AgabiH39|079060
ATGCACCATATTCAGGCGCTTCCACTCGAACTTCTGGGCCTCATTATTGAGTCCTTGTCACACGAGAGGGATGCC
CTCCTTCAGGCCAGCTTGACGTGTAAAGTCTGGCGTTCTATCTGCTACCGCCACTTGTTTTCAGCTGTCATTTTG
AACTCGCGGTCTTTACCGCCTTTCTTTGAGCTCTTGGAGAATCAATTCACACGTACTACTATCCCTTTATGCGTT
CGCCGATTGTCCATCGACTTCCCAGCCCCAACCGCCACTATATACTTTGGTTGGCGCGAGTGCTTGACCAAAATA
CTGATGCACTTGTCCCATGTCGATCGCGTTGCGCATCTCAAACTTTCGAATATGTGTACAACAGACGGCGTACTG
TCCTCTGTGCTGTCTTCTGCTTTTACCAATGCCAACACGCTCGACCTTTCCAATTCTACCTTCGGTGATCCTATG
GCACTAGGAGACTTCCTCGGTGCTTATCCTCACCTCAAACAAGTCGTATTGAGGGATGTTCTCTGCCCAATCCCT
TACTCAGCGTCCCTCTCCCCTCTACCCCCGGTAGGCGCTTATGGACTACAAATCTCGGCGTCCGCTGATTTCGGG
TTCCATGCGAGCCTAAAATGGTGTCGAACCTCAGAGGCTAAGAACTTACAACAATTGGGTGCTGTATCTTTCATA
CACCCGGGCAACATTCATCACGTATTGAATATCCTTGCTCCTTTCTTAAACTTCTTGGAGCTAATGCACCCAGCA
CAAAATGTGGAATCGCAAAACTCCCTCCCGTATGAAATAAATCTCCATAATGCTACACATCTTCGTTTCCTTAGT
CTGGGCTTCCCAGATCGTGTCCTCGGTGTCATGCCATGGATCCTTCGCATATTACATTATCTTCAAGGAAGTTCG
CTACGTGGGTTACGGTTATCTTTTTCCGCTTCCCAACAATTCACCCTCGACATACCCTTTCTCAAACTCCTCCGC
CAAACATTGGAAAAGCCTCAGTTCCGAAGGTTGCAAAGTCTCCAGTTCTTCACCTTCAACACGTTCGGCGATGAA
GATGTTGCCAAACTTGTTGTCAAGCACGTGAGCGAGTCGCTGGACAGTTGGCACGAGCAAGGCAAATTGAGATTT
GCCTTTCCGCCATGA
Gene >AgabiH39|079060
ATGCACCATATTCAGGCGCTTCCACTCGAACTTCTGGGCCTCATTATTGAGTCCTTGTCACACGAGAGGGATGCC
CTCCTTCAGGCCAGCTTGACGTGTAAAGTCTGGCGTTCTATCTGCTACCGCCACTTGTTTTCAGCTGTCATTTTG
AACTCGCGGTCTTTACCGCCTTTCTTTGAGCTCTTGGAGAATCAATTCACACGTACTACTATCCCTTTATGCGTT
CGCCGATTGTCCATCGACTTCCCAGCCCCAACCGCCACTATATACTTTGGTTGGCGCGAGTGCTTGACCAAAATA
CTGATGCACTTGTCCCATGTCGATCGCGTTGCGCATCTCAAACTTTCGAATATGTGTACAACAGACGGCGTACTG
TCCTCTGTGCTGTCTTCTGCTTTTACCAATGCCAACACGCTCGACCTTTCCAATTCTACCTTCGGTGATCCTATG
GCACTAGGAGACTTCCTCGGTGCTTATCCTCACCTCAAACAAGTCGTATTGAGGGATGTTCTCTGCCCAATCCCT
TACTCAGCGTCCCTCTCCCCTCTACCCCCGGTAGGCGCTTATGGACTACAAATCTCGGCGTCCGCTGATTTCGGG
TTCCATGCGAGCCTAAAATGGTGTCGAACCTCAGAGGCTAAGAACTTACAACAATTGGGTGCTGTATCTTTCATA
CACCCGGGCAACATTCATCACGTATTGAATATCCTTGCTCCTTTCTTAAACTTCTTGGAGCTAATGCACCCAGCA
CAAAGTGCGTGATCTCCTCCAAATTCAGCTTACAAGCAAATGACAATTGACAGATGTGGAATCGCAAAACTCCCT
CCCGTATGAAATAAATCTCCATAATGCTACACATCTTCGTTTCCTTAGTCTGGGCTTCCCAGATCGTGTCCTCGG
TGTCATGCCATGGATCCTTCGCATATTACATTATCTTCAAGGAAGTTCGCTACGTGGGTTACGGTTATCTTTTTC
CGCTTCCCAACAATTCACCCTCGACATACCCTTTCTCAAACTCCTCCGCCAAACATTGGAAAAGCCTCAGTTCCG
AAGGTTGCAAAGTCTCCAGTTCTTCACCTTCAACACGTTCGGCGATGAAGATGTTGCCAAACTTGTTGTCAAGCA
CGTGAGCGAGTCGCTGGACAGTTGGCACGAGCAAGGCAAATTGAGATTTGCCTTTCCGCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail