Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|071040
Gene name
Locationscaffold_04:1155909..1157212
Strand-
Gene length (bp)1303
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13460 NAD_binding_10 NAD(P)H-binding 5.2E-09 11 84
PF05368 NmrA NmrA-like family 4.6E-08 9 79

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7K4|YGI2_SCHPO Uncharacterized protein C2A9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2A9.02 PE=3 SV=1 5 323 5.0E-13

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup152
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|071030
Agaricus bisporus var bisporus H39 AgabiH39|071040 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|083920
Agaricus bisporus var bisporus H97 AgabiH97|071030
Agaricus bisporus var bisporus H97 AgabiH97|071040
Agaricus bisporus var bisporus H97 AgabiH97|083920
Rhodonia placenta FPRL280 RhoplFPRL280|233_5
Rhodonia placenta FPRL280 RhoplFPRL280|287_8
Rhodonia placenta FPRL280 RhoplFPRL280|335_4
Rhodonia placenta FPRL280 RhoplFPRL280|335_6
Rhodonia placenta FPRL280 RhoplFPRL280|335_7
Rhodonia placenta FPRL280 RhoplFPRL280|509_3
Rhodonia placenta FPRL280 RhoplFPRL280|594_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|071040
MSSTLKFFFIGATGYVGSSVLERFLDHPEANNFEFTALVRDPRKAEKLKQFGVNAVVGSFDDAKLVEDLTAAADI
VVDMGGSENLGLAKSTLRGFQRKFQETGKPSIFIHTSGTIIIADDAAGLHSSDVVWNDADPDQIEQLPPTAPHID
VELEIIRADMEGYVRAYFVTPGTIYGIASGKFVDAGLAHKHSIHVPALIKTSLDRGQAGMIGKGLNIWPSVHIDE
AADFYIDLYNAIKANPDSVGHGRDGFYFLLNGEHSLYDVGKEIGRALVALGKVTTELPSTYTQEEVNKYFGGSNF
LGTNSRGLANHSKSIGWKPKKTTQDLMASINPEVEEILKHL*
Coding >AgabiH39|071040
ATGTCTTCTACCCTCAAATTCTTTTTCATCGGTGCTACTGGCTACGTCGGCAGCTCTGTTCTAGAGCGCTTCCTT
GATCATCCGGAGGCCAATAATTTCGAATTTACTGCCCTTGTTAGAGACCCTCGGAAAGCGGAGAAATTGAAGCAA
TTCGGCGTAAACGCCGTTGTCGGCTCTTTTGATGATGCTAAGCTCGTCGAGGACTTGACTGCCGCTGCGGACATC
GTGGTTGACATGGGAGGCTCAGAAAATCTCGGACTTGCCAAAAGTACACTTCGCGGCTTCCAAAGAAAGTTCCAA
GAAACAGGAAAACCTTCAATTTTTATTCACACCTCCGGAACCATCATCATAGCCGATGATGCAGCGGGTCTTCAT
TCTTCTGATGTCGTCTGGAACGATGCCGATCCTGACCAGATAGAGCAACTGCCACCAACTGCACCCCATATCGAC
GTAGAATTGGAGATCATCCGGGCCGATATGGAGGGTTACGTTCGCGCTTACTTCGTGACTCCCGGCACAATATAT
GGAATTGCCTCTGGAAAGTTCGTAGATGCCGGTCTCGCTCATAAGCATTCTATTCACGTACCTGCTCTCATCAAG
ACCTCACTCGATAGAGGACAGGCTGGGATGATCGGTAAAGGATTGAACATCTGGCCAAGCGTTCATATTGATGAA
GCCGCCGATTTCTATATCGACCTTTATAACGCAATCAAAGCCAACCCCGACTCCGTTGGTCATGGCCGTGATGGG
TTCTATTTTCTGTTGAATGGAGAACACAGTCTCTACGATGTTGGCAAAGAGATCGGCCGCGCACTAGTTGCGCTC
GGCAAGGTAACCACCGAATTGCCTTCCACATACACCCAAGAAGAAGTGAATAAGTATTTTGGAGGATCTAATTTC
TTGGGCACAAACTCGAGGGGTTTGGCCAATCACTCGAAATCCATCGGGTGGAAACCGAAGAAAACAACCCAAGAT
CTTATGGCGAGCATTAATCCTGAAGTAGAGGAGATTCTCAAGCATTTGTAA
Transcript >AgabiH39|071040
ATGTCTTCTACCCTCAAATTCTTTTTCATCGGTGCTACTGGCTACGTCGGCAGCTCTGTTCTAGAGCGCTTCCTT
GATCATCCGGAGGCCAATAATTTCGAATTTACTGCCCTTGTTAGAGACCCTCGGAAAGCGGAGAAATTGAAGCAA
TTCGGCGTAAACGCCGTTGTCGGCTCTTTTGATGATGCTAAGCTCGTCGAGGACTTGACTGCCGCTGCGGACATC
GTGGTTGACATGGGAGGCTCAGAAAATCTCGGACTTGCCAAAAGTACACTTCGCGGCTTCCAAAGAAAGTTCCAA
GAAACAGGAAAACCTTCAATTTTTATTCACACCTCCGGAACCATCATCATAGCCGATGATGCAGCGGGTCTTCAT
TCTTCTGATGTCGTCTGGAACGATGCCGATCCTGACCAGATAGAGCAACTGCCACCAACTGCACCCCATATCGAC
GTAGAATTGGAGATCATCCGGGCCGATATGGAGGGTTACGTTCGCGCTTACTTCGTGACTCCCGGCACAATATAT
GGAATTGCCTCTGGAAAGTTCGTAGATGCCGGTCTCGCTCATAAGCATTCTATTCACGTACCTGCTCTCATCAAG
ACCTCACTCGATAGAGGACAGGCTGGGATGATCGGTAAAGGATTGAACATCTGGCCAAGCGTTCATATTGATGAA
GCCGCCGATTTCTATATCGACCTTTATAACGCAATCAAAGCCAACCCCGACTCCGTTGGTCATGGCCGTGATGGG
TTCTATTTTCTGTTGAATGGAGAACACAGTCTCTACGATGTTGGCAAAGAGATCGGCCGCGCACTAGTTGCGCTC
GGCAAGGTAACCACCGAATTGCCTTCCACATACACCCAAGAAGAAGTGAATAAGTATTTTGGAGGATCTAATTTC
TTGGGCACAAACTCGAGGGGTTTGGCCAATCACTCGAAATCCATCGGGTGGAAACCGAAGAAAACAACCCAAGAT
CTTATGGCGAGCATTAATCCTGAAGTAGAGGAGATTCTCAAGCATTTGTAA
Gene >AgabiH39|071040
ATGTCTTCTACCCTCAAATTCTTTTTCATCGGTGCTACTGGTCAGCTCAAATTCACATTTCTTTGCAATAGTTCG
TCTCAGACTAATCATCCTCAGGCTACGTCGGCAGCTCTGTTCTAGAGCGCTTCCTTGATCATCCGGAGGCCAATA
ATTTCGAATTTACTGCCCTTGTTAGAGACCCTCGGAAAGCGGAGAAATTGAAGCAATTCGGCGTAAACGCCGTTG
TCGGCTCTTTTGATGATGCTAAGCTCGTCGAGGACTTGACTGCCGCTGCGGACATCGTGGTTGACATGGTTAGTT
GGAATAATATTCATTCGTTCATAAGGTAGTCTTAAAAACCCATGCTTCAGGGAGGCTCAGAAAATCTCGGACTTG
CCAAAAGTACACTTCGCGGCTTCCAAAGAAAGTTCCAAGAAACAGGAAAACCTTCAATTTTTATTCACACCGTAA
GTCTTCGTGGATATCTATTTGGGGCTAGCCGTTCCTACTCAACTCTCCAGTCCGGAACCATCATCATAGCCGATG
ATGCAGCGGGTCTTCATTCTTCTGATGTCGTCTGGAACGATGCCGATCCTGACCAGATAGAGCAACTGCCACCAA
CTGCACCCCATATCGACGTAGAATTGGAGATCATCCGGGCCGATATGGAGGGTTACGTTCGCGCTTACTTCGTGA
CTCCCGGCACAATATATGGAATTGCCTCTGGAAAGTTCGTAGATGCCGGTCTCGCTCATAAGCATTCTATTCACG
TACCTGCTCTCATCAAGACCTCACTCGATAGAGGACAGGCTGGGATGATCGGTAAAGGATTGAACATCTGGCCAA
GCGTTCATATTGATGAAGGTCAGCTCACTGACTCCCTTGGTCCGAGTCCGTTCATTTATTTGGAAATTAGCCGCC
GATTTCTATATCGACCTTTATAACGCAATCAAAGCCAACCCCGACTCCGTTGGTCATGGCCGTGATGGGTTCTAT
TTTCTGTTGAATGGAGAACACAGTCTCTACGATGTTGGCAAAGAGATCGGCCGCGCACTAGTTGCGCTCGGCAAG
GTAACCACCGAATTGCCTTCCACATACACCCAAGAAGAAGTGAATAAGTATTTTGGAGTGAGTTTTTATCATTCT
TGGGCTCGTTGAGGGCAGGTTGAACTTGACGTTTTCATAGGGATCTAATTTCTTGGGCACAAACTCGAGGGGTTT
GGCCAATCACTCGAAATCCATCGGGTGGAAACCGAAGAAAACAACCCAAGATCTTATGGCGAGCATTAATCCTGA
AGTAGAGGAGATTCTCAAGCATTTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail