Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|069420
Gene name
Locationscaffold_04:2667261..2668331
Strand-
Gene length (bp)1070
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 1.1E-11 39 196
PF13649 Methyltransf_25 Methyltransferase domain 9.3E-11 45 139
PF08241 Methyltransf_11 Methyltransferase domain 1.2E-06 46 141
PF13847 Methyltransf_31 Methyltransferase domain 1.3E-06 44 162
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 4.5E-05 37 173

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P67063|MENG_STAAW Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 24 199 2.0E-06
sp|A8Z450|MENG_STAAT Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 24 199 2.0E-06
sp|Q6G992|MENG_STAAS Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 24 199 2.0E-06
sp|P67062|MENG_STAAN Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 24 199 2.0E-06
sp|P67061|MENG_STAAM Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 24 199 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P67063|MENG_STAAW Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 24 199 2.0E-06
sp|A8Z450|MENG_STAAT Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 24 199 2.0E-06
sp|Q6G992|MENG_STAAS Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 24 199 2.0E-06
sp|P67062|MENG_STAAN Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 24 199 2.0E-06
sp|P67061|MENG_STAAM Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 24 199 2.0E-06
sp|A6QH20|MENG_STAAE Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 24 199 2.0E-06
sp|Q5HFV2|MENG_STAAC Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 24 199 2.0E-06
sp|A5ISZ9|MENG_STAA9 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 24 199 2.0E-06
sp|A6U1T9|MENG_STAA2 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 24 199 2.0E-06
sp|A7X2H6|MENG_STAA1 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 24 199 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup288
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|023670
Agaricus bisporus var bisporus H39 AgabiH39|030510
Agaricus bisporus var bisporus H39 AgabiH39|062930
Agaricus bisporus var bisporus H39 AgabiH39|062940
Agaricus bisporus var bisporus H39 AgabiH39|062950
Agaricus bisporus var bisporus H39 AgabiH39|062970
Agaricus bisporus var bisporus H39 AgabiH39|062990
Agaricus bisporus var bisporus H39 AgabiH39|069420 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|294900
Agaricus bisporus var bisporus H39 AgabiH39|387000
Agaricus bisporus var bisporus H97 AgabiH97|069430
Agaricus bisporus var bisporus H97 AgabiH97|069420
Agaricus bisporus var bisporus H97 AgabiH97|062990
Agaricus bisporus var bisporus H97 AgabiH97|062970
Agaricus bisporus var bisporus H97 AgabiH97|062960
Agaricus bisporus var bisporus H97 AgabiH97|023670
Agaricus bisporus var bisporus H97 AgabiH97|062940
Agaricus bisporus var bisporus H97 AgabiH97|062930
Agaricus bisporus var bisporus H97 AgabiH97|030510
Agaricus bisporus var bisporus H97 AgabiH97|096710
Agaricus bisporus var bisporus H97 AgabiH97|062950
Rhodonia placenta FPRL280 RhoplFPRL280|71_4

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|069420
MPKTTGQRDIMSLMPPNLTSSSIVSQRTNRNENVLIFRAKCGAIVLDSGTGSGHWLLSLAKEVPSTVVLRGIDIS
PRMFPSTTTIPDNMSLMSHSITSLPEDWTNTVTLIHQRLLVAAFQVDQWKTAVSEMYRVLAPGGWVQLFEPREQL
LSPLEAITNHKTLRILERLMADTRHIVNDVVDHLQHWLEEAGFVNLTIQKRGMPIGSWAGERGVLSMEATLGAFE
AMKPLVIKEGGLGIVSSEEEFDAALADLRRLCDDTPDTYFQYWLFTAQKPLPKV*
Coding >AgabiH39|069420
ATGCCGAAAACAACGGGACAGAGAGATATTATGTCTCTGATGCCTCCGAATCTAACAAGTTCAAGTATTGTCTCC
CAGCGGACGAACAGGAACGAGAACGTCTTGATCTTCAGAGCGAAATGTGGAGCCATCGTCCTCGATAGTGGAACT
GGCTCAGGTCACTGGTTACTGAGCCTCGCTAAAGAGGTGCCCTCAACAGTCGTTCTCCGTGGAATCGACATCAGT
CCTCGAATGTTCCCATCAACCACAACGATCCCCGATAATATGTCCCTGATGTCACATTCAATAACTTCTCTGCCA
GAGGATTGGACTAATACCGTGACGCTCATCCACCAACGCCTTTTGGTTGCCGCATTTCAAGTCGACCAATGGAAG
ACTGCGGTATCCGAAATGTATAGAGTTCTCGCACCCGGTGGATGGGTTCAACTCTTCGAACCAAGAGAACAGCTC
CTTTCACCCCTCGAGGCTATCACCAATCACAAAACTCTGCGTATTTTGGAAAGACTTATGGCGGATACCAGGCAT
ATAGTCAATGACGTTGTTGATCACCTTCAACACTGGCTCGAAGAAGCCGGCTTTGTTAATCTAACCATCCAGAAA
CGGGGAATGCCAATTGGATCGTGGGCAGGAGAGCGTGGTGTTTTGAGCATGGAAGCCACTCTGGGGGCATTTGAA
GCTATGAAACCGCTCGTCATAAAGGAGGGTGGCCTTGGTATTGTATCCAGTGAGGAGGAGTTTGATGCAGCGTTG
GCAGACCTCAGGCGACTTTGCGACGACACACCAGACACGTACTTTCAGTATTGGTTATTTACGGCACAGAAACCT
CTGCCTAAAGTGTAA
Transcript >AgabiH39|069420
ATGCCGAAAACAACGGGACAGAGAGATATTATGTCTCTGATGCCTCCGAATCTAACAAGTTCAAGTATTGTCTCC
CAGCGGACGAACAGGAACGAGAACGTCTTGATCTTCAGAGCGAAATGTGGAGCCATCGTCCTCGATAGTGGAACT
GGCTCAGGTCACTGGTTACTGAGCCTCGCTAAAGAGGTGCCCTCAACAGTCGTTCTCCGTGGAATCGACATCAGT
CCTCGAATGTTCCCATCAACCACAACGATCCCCGATAATATGTCCCTGATGTCACATTCAATAACTTCTCTGCCA
GAGGATTGGACTAATACCGTGACGCTCATCCACCAACGCCTTTTGGTTGCCGCATTTCAAGTCGACCAATGGAAG
ACTGCGGTATCCGAAATGTATAGAGTTCTCGCACCCGGTGGATGGGTTCAACTCTTCGAACCAAGAGAACAGCTC
CTTTCACCCCTCGAGGCTATCACCAATCACAAAACTCTGCGTATTTTGGAAAGACTTATGGCGGATACCAGGCAT
ATAGTCAATGACGTTGTTGATCACCTTCAACACTGGCTCGAAGAAGCCGGCTTTGTTAATCTAACCATCCAGAAA
CGGGGAATGCCAATTGGATCGTGGGCAGGAGAGCGTGGTGTTTTGAGCATGGAAGCCACTCTGGGGGCATTTGAA
GCTATGAAACCGCTCGTCATAAAGGAGGGTGGCCTTGGTATTGTATCCAGTGAGGAGGAGTTTGATGCAGCGTTG
GCAGACCTCAGGCGACTTTGCGACGACACACCAGACACGTACTTTCAGTATTGGTTATTTACGGCACAGAAACCT
CTGCCTAAAGTGTAA
Gene >AgabiH39|069420
ATGCCGGTAAGTTCCAGTTACCCAGCCTGGAGGCCCATGTCACCTACATCCGCAGCTCATACTATGCCTTCCTCA
GAAAACAACGGGACAGAGAGATATTATGTCTCTGATGCCTCCGAATCTAACAAGTTCAAGTATTGTCTCCCAGCG
GACGAACAGGAACGAGAACGGTAAGACTTAGCAATGATGAGAGTCCGTCACTGACTCATTTCTCTCATTGCTCAG
TCTTGATCTTCAGAGCGAAATGGTCAATCTGACGTTCGAAAACAAATTGATTTGGGCTCCAGTCACACTCGAAAG
TGGAGCCATCGTCCTCGATAGTGGAACTGGCTCAGGTATTTCAAGAATAACTTGAAGCACATTTTCGAAGTAACA
ACAAAATTTTAGGTCACTGGTTACTGAGCCTCGCTAAAGAGGTGCCCTCAACAGTCGTTCTCCGTGGAATCGACA
TCAGTCCTCGAATGTTCCCATCAACCACAACGATCCCCGATAATATGTCCCTGATGTCACATTCAATAACTTCTC
TGCCAGAGGATTGGACTAATACCGTGACGCTCATCCACCAACGCCTTTTGGTTGCCGCATTTCAAGTCGACCAAT
GGAAGACTGCGGTATCCGAAATGTATAGAGTTCTCGCACCCGGTGGATGGGTTCAACTCTTCGAACCAAGAGAAC
AGCTCCTTTCACCCCTCGAGGCTATCACCAATCACAAAACTCTGCGTATTTTGGAAAGACTTATGGCGGATACCA
GGCATATAGTCAATGACGTTGTTGATCACCTTCAACACTGGCTCGAAGAAGCCGGCTTTGTTAATCTAACCATCC
AGAAACGGGGAATGCCAATTGGATCGTGGGCAGGAGAGCGTGGTGTTTTGAGCATGGAAGCCACTCTGGGGGCAT
TTGAAGCTATGAAACCGCTCGTCATAAAGGAGGGTGGCCTTGGTATTGTATCCAGTGAGGAGGAGTTTGATGCAG
CGTTGGCAGACCTCAGGCGACTTTGCGACGACACACCAGACACGTACTTTCAGTATTGGTTATTTACGGCACAGA
AACCTCTGCCTAAAGTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail