Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|067670
Gene name
Locationscaffold_04:589605..591498
Strand-
Gene length (bp)1893
Transcript length (bp)1677
Coding sequence length (bp)1677
Protein length (aa) 559

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05783 DLIC Dynein light intermediate chain (DLIC) 1.2E-32 14 271
PF05783 DLIC Dynein light intermediate chain (DLIC) 4.2E-02 312 347

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R1Q8|DC1L1_MOUSE Cytoplasmic dynein 1 light intermediate chain 1 OS=Mus musculus GN=Dync1li1 PE=1 SV=1 14 345 5.0E-30
sp|Q9QXU8|DC1L1_RAT Cytoplasmic dynein 1 light intermediate chain 1 OS=Rattus norvegicus GN=Dync1li1 PE=1 SV=1 14 345 5.0E-30
sp|Q9Y6G9|DC1L1_HUMAN Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens GN=DYNC1LI1 PE=1 SV=3 14 345 3.0E-29
sp|Q90828|DC1L1_CHICK Cytoplasmic dynein 1 light intermediate chain 1 OS=Gallus gallus GN=DYNC1LI1 PE=1 SV=1 14 360 5.0E-29
sp|Q62698|DC1L2_RAT Cytoplasmic dynein 1 light intermediate chain 2 OS=Rattus norvegicus GN=Dync1li2 PE=1 SV=1 7 356 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R1Q8|DC1L1_MOUSE Cytoplasmic dynein 1 light intermediate chain 1 OS=Mus musculus GN=Dync1li1 PE=1 SV=1 14 345 5.0E-30
sp|Q9QXU8|DC1L1_RAT Cytoplasmic dynein 1 light intermediate chain 1 OS=Rattus norvegicus GN=Dync1li1 PE=1 SV=1 14 345 5.0E-30
sp|Q9Y6G9|DC1L1_HUMAN Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens GN=DYNC1LI1 PE=1 SV=3 14 345 3.0E-29
sp|Q90828|DC1L1_CHICK Cytoplasmic dynein 1 light intermediate chain 1 OS=Gallus gallus GN=DYNC1LI1 PE=1 SV=1 14 360 5.0E-29
sp|Q62698|DC1L2_RAT Cytoplasmic dynein 1 light intermediate chain 2 OS=Rattus norvegicus GN=Dync1li2 PE=1 SV=1 7 356 1.0E-28
sp|O43237|DC1L2_HUMAN Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens GN=DYNC1LI2 PE=1 SV=1 7 356 3.0E-28
sp|Q4R5P6|DC1L2_MACFA Cytoplasmic dynein 1 light intermediate chain 2 OS=Macaca fascicularis GN=DYNC1LI2 PE=2 SV=1 7 356 4.0E-28
sp|Q5RE09|DC1L2_PONAB Cytoplasmic dynein 1 light intermediate chain 2 OS=Pongo abelii GN=DYNC1LI2 PE=2 SV=1 7 356 5.0E-28
sp|Q6PDL0|DC1L2_MOUSE Cytoplasmic dynein 1 light intermediate chain 2 OS=Mus musculus GN=Dync1li2 PE=1 SV=2 7 356 8.0E-28
sp|Q54CI8|DC1L1_DICDI Cytoplasmic dynein 1 light intermediate chain 1 OS=Dictyostelium discoideum GN=dync1li1 PE=3 SV=1 14 340 6.0E-24
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup4194
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|067670 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|067670
Rhodonia placenta FPRL280 RhoplFPRL280|193_7

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|067670
MDNSRSTTPEALPENLWSSILDSVSTSRSLPSKQILLLGQPSTGKSTIASALLQRPVSSEESQDDKRVDFAVGYE
FADVRDDGDEDTIARLSVYTVPSSNSSYTTLLPHFLHPRTALTHSLVMIVLDWTRPWSFVEELQTWLLWIERWVK
GDGSRELEMVREECRERLQSYLQHYSEPSTDLLPASTSALSNTVLPLGPGTLTHNTAGVPIIVVCSKADLIDEEN
DVVASAAGMGGMVKGKGGEWEERTDGIMQVLRTICLKYGASLFYTTPQPTTLQVLRQHALHLLFVPPPPSPAMGG
GSDAPAPVRNPFPFQHKPNTLDRDRIVVPVGWDSWGKISVLREGFDAKFWGEAWENDLEEVEGQSSGETGAKKLF
TVLVPDQGEKPRILPPINNPMPEQTFLMKHYDENSKKADRDPRASFRNPTDLTTGAPVGIVGPLGSSSFSMPNVE
RVLNDMENSTIAASNSANQAAEARKFPNRPTGRPGGIAGLNASTNATPSARTPTSPPTTSPTGGQPSQHEVLQHF
FWSLLNSKDRAGGKDPNAANTSPPAKTNGQTEE*
Coding >AgabiH39|067670
ATGGATAATTCGCGTTCAACAACGCCGGAAGCACTACCCGAAAATCTCTGGTCATCTATCTTAGATTCTGTGTCG
ACATCCCGCTCTCTTCCCTCAAAACAAATCCTGCTTCTTGGACAACCCTCAACCGGAAAGTCGACAATCGCATCT
GCACTGCTACAGAGACCTGTATCTTCTGAAGAAAGTCAGGATGATAAGAGGGTGGACTTTGCCGTTGGTTATGAG
TTTGCTGACGTTAGGGACGACGGTGATGAAGATACTATAGCGCGGTTATCGGTCTATACCGTGCCGTCGTCAAAT
TCATCATATACAACATTGTTGCCACACTTTCTGCATCCAAGAACGGCACTAACACACTCGTTGGTGATGATCGTA
CTAGATTGGACGAGACCATGGTCGTTTGTGGAGGAACTACAGACTTGGTTACTATGGATTGAACGATGGGTCAAA
GGAGATGGTTCCAGAGAGCTTGAGATGGTGCGCGAAGAGTGCCGTGAGCGATTACAGTCATATCTGCAACATTAT
TCTGAGCCGTCTACTGATCTGCTGCCTGCATCTACCTCTGCATTGAGTAACACCGTCTTACCCCTTGGCCCAGGT
ACATTGACACACAATACTGCGGGCGTGCCAATAATTGTTGTGTGTAGCAAGGCAGATTTGATAGACGAAGAGAAT
GACGTGGTTGCTAGTGCTGCAGGTATGGGTGGCATGGTTAAAGGGAAGGGTGGTGAGTGGGAGGAGCGGACGGAC
GGAATCATGCAGGTTCTACGGACGATCTGCCTTAAGTATGGTGCATCACTATTCTACACGACCCCTCAACCCACC
ACTCTCCAGGTTCTGCGACAGCATGCTTTACACTTACTCTTTGTGCCACCACCACCTTCACCTGCAATGGGCGGT
GGATCGGATGCTCCAGCTCCAGTCCGAAATCCCTTCCCTTTCCAGCATAAACCAAACACGCTTGATCGAGACCGC
ATTGTAGTGCCTGTCGGATGGGATAGCTGGGGTAAAATATCCGTCTTGAGAGAGGGCTTTGATGCCAAGTTCTGG
GGCGAGGCTTGGGAAAATGATCTTGAGGAAGTTGAGGGACAAAGTAGTGGGGAAACAGGTGCCAAGAAGCTCTTC
ACAGTTTTAGTCCCGGACCAAGGCGAAAAGCCTCGCATTCTTCCACCCATCAACAATCCAATGCCAGAACAAACG
TTCCTTATGAAGCACTACGACGAAAACTCTAAGAAAGCCGATAGAGACCCTCGCGCTTCGTTCAGGAATCCGACG
GATCTAACCACAGGTGCTCCTGTGGGTATCGTTGGCCCTCTTGGAAGCAGCAGCTTTAGCATGCCCAATGTCGAA
CGTGTACTCAATGATATGGAGAACTCGACGATTGCGGCTTCGAATTCAGCCAATCAGGCTGCCGAAGCGCGCAAA
TTCCCTAATCGGCCTACGGGAAGGCCGGGTGGGATTGCGGGGCTCAATGCATCCACCAACGCGACACCATCTGCT
CGTACTCCCACATCGCCTCCCACGACGAGTCCTACTGGTGGACAACCAAGTCAACATGAAGTTTTGCAGCATTTC
TTCTGGAGCCTACTGAACTCCAAAGACCGTGCTGGAGGAAAAGATCCCAACGCGGCCAATACGTCGCCGCCAGCG
AAGACCAATGGGCAGACAGAAGAATAG
Transcript >AgabiH39|067670
ATGGATAATTCGCGTTCAACAACGCCGGAAGCACTACCCGAAAATCTCTGGTCATCTATCTTAGATTCTGTGTCG
ACATCCCGCTCTCTTCCCTCAAAACAAATCCTGCTTCTTGGACAACCCTCAACCGGAAAGTCGACAATCGCATCT
GCACTGCTACAGAGACCTGTATCTTCTGAAGAAAGTCAGGATGATAAGAGGGTGGACTTTGCCGTTGGTTATGAG
TTTGCTGACGTTAGGGACGACGGTGATGAAGATACTATAGCGCGGTTATCGGTCTATACCGTGCCGTCGTCAAAT
TCATCATATACAACATTGTTGCCACACTTTCTGCATCCAAGAACGGCACTAACACACTCGTTGGTGATGATCGTA
CTAGATTGGACGAGACCATGGTCGTTTGTGGAGGAACTACAGACTTGGTTACTATGGATTGAACGATGGGTCAAA
GGAGATGGTTCCAGAGAGCTTGAGATGGTGCGCGAAGAGTGCCGTGAGCGATTACAGTCATATCTGCAACATTAT
TCTGAGCCGTCTACTGATCTGCTGCCTGCATCTACCTCTGCATTGAGTAACACCGTCTTACCCCTTGGCCCAGGT
ACATTGACACACAATACTGCGGGCGTGCCAATAATTGTTGTGTGTAGCAAGGCAGATTTGATAGACGAAGAGAAT
GACGTGGTTGCTAGTGCTGCAGGTATGGGTGGCATGGTTAAAGGGAAGGGTGGTGAGTGGGAGGAGCGGACGGAC
GGAATCATGCAGGTTCTACGGACGATCTGCCTTAAGTATGGTGCATCACTATTCTACACGACCCCTCAACCCACC
ACTCTCCAGGTTCTGCGACAGCATGCTTTACACTTACTCTTTGTGCCACCACCACCTTCACCTGCAATGGGCGGT
GGATCGGATGCTCCAGCTCCAGTCCGAAATCCCTTCCCTTTCCAGCATAAACCAAACACGCTTGATCGAGACCGC
ATTGTAGTGCCTGTCGGATGGGATAGCTGGGGTAAAATATCCGTCTTGAGAGAGGGCTTTGATGCCAAGTTCTGG
GGCGAGGCTTGGGAAAATGATCTTGAGGAAGTTGAGGGACAAAGTAGTGGGGAAACAGGTGCCAAGAAGCTCTTC
ACAGTTTTAGTCCCGGACCAAGGCGAAAAGCCTCGCATTCTTCCACCCATCAACAATCCAATGCCAGAACAAACG
TTCCTTATGAAGCACTACGACGAAAACTCTAAGAAAGCCGATAGAGACCCTCGCGCTTCGTTCAGGAATCCGACG
GATCTAACCACAGGTGCTCCTGTGGGTATCGTTGGCCCTCTTGGAAGCAGCAGCTTTAGCATGCCCAATGTCGAA
CGTGTACTCAATGATATGGAGAACTCGACGATTGCGGCTTCGAATTCAGCCAATCAGGCTGCCGAAGCGCGCAAA
TTCCCTAATCGGCCTACGGGAAGGCCGGGTGGGATTGCGGGGCTCAATGCATCCACCAACGCGACACCATCTGCT
CGTACTCCCACATCGCCTCCCACGACGAGTCCTACTGGTGGACAACCAAGTCAACATGAAGTTTTGCAGCATTTC
TTCTGGAGCCTACTGAACTCCAAAGACCGTGCTGGAGGAAAAGATCCCAACGCGGCCAATACGTCGCCGCCAGCG
AAGACCAATGGGCAGACAGAAGAATAG
Gene >AgabiH39|067670
ATGGATAATTCGCGTTCAACAACGCCGGAAGCACTACCCGAAAATCTCTGGTCATCTATCTTAGATTCTGTGTCG
ACATCCCGCTCTCTTCCCTCAAAACAAATCCTGCTTCTTGGACAACCCTCAACCGGAAAGTCGACAATCGCATCT
GCACTGCTACAGAGACCTGTATCTTCTGAAGAAAGTCAGGATGATAAGAGGGTGGACTTTGCCGTTGGTTATGAG
TTTGCTGACGTTAGGGACGACGGTGATGAAGGTGCGTCGCGGCCGCACGATTGGGTCAGACGGGATTTTGCAGCT
CAAACACCAGTACAGATACTATAGCGCGGTTATCGGTCTATACCGTGCCGTCGTCAAATTCATCATATACAACAT
TGTTGCCACACTTTCTGCATCCAAGAACGGCACTAACACACTCGTTGGTGATGATCGTACTAGATTGGACGAGAC
CATGGTCGTTTGTGGAGGAACTACAGACTTGGTTACTATGGATTGAACGATGGGTCAAAGGAGATGGTTCCAGAG
AGCTTGAGATGGTGCGCGAAGAGTGCCGTGAGCGATGTAAGTACAAACGTAAAGGTGTCCTGTTACCGAGAGAGA
TTAATGAGGCCACAGTACAGTCATATCTGCAACATTATTCTGAGCCGTCTACTGATCTGCTGCCTGCATCTACCT
CTGCATTGAGTAACACCGTCTTACCCCTTGGCCCAGGTACATTGACACACAATACTGCGGGCGTGCCAATAATTG
TTGTGTGTAGCAAGGCAGATTTGATAGACGAAGAGAATGACGTGGTTGCTAGTGCTGCAGGTATGGGTGGCATGG
TTAAAGGGAAGGGTGGTGAGTGGGAGGAGCGGACGGACGGAATCATGCAGGTTCTACGGACGATCTGCCTTAAGT
GTAAGCAGCCCCTCTTTCGCACCCGAACGGCTACTGACTTTATGTTTACAGATGGTGCATCACTATTCTACACGA
CCCCTCAACCCACCACTCTCCAGGTTCTGCGACAGCATGCTTTACACTTACTCTTTGTGCCACCACCACCTTCAC
CTGCAATGGGCGGTGGATCGGATGCTCCAGCTCCAGTCCGAAATCCCTTCCCTTTCCAGCATAAACCAAACACGC
TTGATCGAGACCGCATTGTAGTGCCTGTCGGATGGGATAGCTGGGGTAAAATATCCGTCTTGAGAGAGGGCTTTG
ATGCCAAGTTCTGGGGCGAGGCTTGGGAAAATGATCTTGAGGAAGTTGAGGGACAAAGTAGTGGGGAAACAGGTG
CCAAGAAGCTCTTCACAGTTTTAGTCCCGGACCAAGGCGAAAAGGTACATTTTAAGAATTGTTTCTTTACTATTG
CTAAACGATGCCTCTGTGTAGCCTCGCATTCTTCCACCCATCAACAATCCAATGCCAGAACAAACGTTCCTTATG
AAGCACTACGACGAAAACTCTAAGAAAGCCGATAGAGACCCTCGCGCTTCGTTCAGGAATCCGACGGATCTAACC
ACAGGTGCTCCTGTGGGTATCGTTGGCCCTCTTGGAAGCAGCAGCTTTAGCATGCCCAATGTCGAACGTGTACTC
AATGATATGGAGAACTCGACGATTGCGGCTTCGAATTCAGCCAATCAGGCTGCCGAAGCGCGCAAATTCCCTAAT
CGGCCTACGGGAAGGCCGGGTGGGATTGCGGGGCTCAATGCATCCACCAACGCGACACCATCTGCTCGTACTCCC
ACATCGCCTCCCACGACGAGTCCTACTGGTGGACAACCAAGTCAACATGAAGTTTTGCAGCATTTCTTCTGGAGC
CTACTGAACTCCAAAGACCGTGCTGGAGGAAAAGATCCCAACGCGGCCAATACGTCGCCGCCAGCGAAGACCAAT
GGGCAGACAGAAGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail