Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|065380
Gene name
Locationscaffold_03:3084431..3085021
Strand-
Gene length (bp)590
Transcript length (bp)396
Coding sequence length (bp)396
Protein length (aa) 132

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999726

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup12534
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|065380 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|065380

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|065380
MFKSTLIALALFMSLGADAYVCSCGDRNYSNGDIFGAVNKGYSIDQAANQPDGKFPHRYLPATSIEYPWCGDGHY
AEYPLQQVPPGPYESGDPGSDRAIYLVGRRRTFCGCMTLAKNSGDTEDLVLCENDG*
Coding >AgabiH39|065380
ATGTTCAAATCGACATTGATTGCGCTCGCCTTGTTCATGTCCTTGGGCGCAGACGCCTACGTTTGTTCCTGTGGT
GATAGAAACTACAGCAATGGCGACATTTTCGGTGCGGTTAACAAAGGATATAGCATAGACCAAGCTGCCAATCAA
CCCGATGGAAAATTTCCCCACAGGTATCTCCCCGCAACGTCCATTGAATACCCTTGGTGTGGGGATGGTCATTAC
GCCGAATATCCTCTCCAACAAGTACCACCAGGTCCATATGAATCTGGGGACCCTGGGTCAGATCGCGCGATTTAC
TTGGTCGGCAGGAGAAGAACATTTTGTGGCTGTATGACTCTCGCTAAAAACTCTGGGGATACTGAAGATCTTGTA
CTCTGCGAGAATGATGGTTAA
Transcript >AgabiH39|065380
ATGTTCAAATCGACATTGATTGCGCTCGCCTTGTTCATGTCCTTGGGCGCAGACGCCTACGTTTGTTCCTGTGGT
GATAGAAACTACAGCAATGGCGACATTTTCGGTGCGGTTAACAAAGGATATAGCATAGACCAAGCTGCCAATCAA
CCCGATGGAAAATTTCCCCACAGGTATCTCCCCGCAACGTCCATTGAATACCCTTGGTGTGGGGATGGTCATTAC
GCCGAATATCCTCTCCAACAAGTACCACCAGGTCCATATGAATCTGGGGACCCTGGGTCAGATCGCGCGATTTAC
TTGGTCGGCAGGAGAAGAACATTTTGTGGCTGTATGACTCTCGCTAAAAACTCTGGGGATACTGAAGATCTTGTA
CTCTGCGAGAATGATGGTTAA
Gene >AgabiH39|065380
ATGTTCAAATCGACATTGATTGCGCTCGCCTTGTTCATGTCCTTGGGCGCAGACGCCTACGTTTGTTCCTGTGGT
GGTGGGTCTAATTCAAATCCCTCGACATGATGTGGCAGTGGCATTTCTCTTTAAGGCTGACTGTACAAATCGCCT
GTCGATCCAGATAGAAACTACAGCAATGGCGACATTTTCGGTGCGGTTAACAAAGGATATAGCATAGACCAAGCT
GCCAATCAACCCGAGTGAGCCTAGAAATCACCAGGATATAAACCGTTTCCGCTAACACGATGAAAAGTGGAAAAT
TTCCCCACAGGTATCTCCCCGCAACGTCCATTGAATACCCTTGGTGTGGGGATGGTCATTACGCCGAATATCCTC
TCCAACAAGTACCACCAGGTCCATATGAATCTGGGGACCCTGGGTCAGATCGCGCGATTTACTTGGTCGGCAGGA
GAAGAACATTTTGTGGTCCGTTGCTTTAATTATGATTGACTACTCTGATGATGATCAAAATTCACATCCCAGGCT
GTATGACTCTCGCTAAAAACTCTGGGGATACTGAAGATCTTGTACTCTGCGAGAATGATGGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail