Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|064950
Gene name
Locationscaffold_03:2968946..2971262
Strand+
Gene length (bp)2316
Transcript length (bp)2094
Coding sequence length (bp)2094
Protein length (aa) 698

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.3E-86 106 559

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60135|LCF1_SCHPO Long-chain-fatty-acid--CoA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf1 PE=3 SV=1 22 693 2.0E-162
sp|Q9P7D7|LCF2_SCHPO Long-chain-fatty-acid--CoA ligase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf2 PE=3 SV=1 26 697 1.0E-154
sp|P30624|LCF1_YEAST Long-chain-fatty-acid--CoA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA1 PE=1 SV=1 30 693 6.0E-150
sp|P39002|LCF3_YEAST Long-chain-fatty-acid--CoA ligase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA3 PE=1 SV=1 30 694 2.0E-149
sp|P47912|LCF4_YEAST Long-chain-fatty-acid--CoA ligase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA4 PE=1 SV=1 30 694 3.0E-145
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60135|LCF1_SCHPO Long-chain-fatty-acid--CoA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf1 PE=3 SV=1 22 693 2.0E-162
sp|Q9P7D7|LCF2_SCHPO Long-chain-fatty-acid--CoA ligase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf2 PE=3 SV=1 26 697 1.0E-154
sp|P30624|LCF1_YEAST Long-chain-fatty-acid--CoA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA1 PE=1 SV=1 30 693 6.0E-150
sp|P39002|LCF3_YEAST Long-chain-fatty-acid--CoA ligase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA3 PE=1 SV=1 30 694 2.0E-149
sp|P47912|LCF4_YEAST Long-chain-fatty-acid--CoA ligase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA4 PE=1 SV=1 30 694 3.0E-145
sp|O35547|ACSL4_RAT Long-chain-fatty-acid--CoA ligase 4 OS=Rattus norvegicus GN=Acsl4 PE=1 SV=1 49 696 4.0E-104
sp|O60488|ACSL4_HUMAN Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens GN=ACSL4 PE=1 SV=2 49 696 2.0E-103
sp|Q9QUJ7|ACSL4_MOUSE Long-chain-fatty-acid--CoA ligase 4 OS=Mus musculus GN=Acsl4 PE=1 SV=2 49 696 4.0E-103
sp|Q1ZXQ4|FCSB_DICDI Fatty acyl-CoA synthetase B OS=Dictyostelium discoideum GN=fcsB PE=2 SV=1 19 693 3.0E-97
sp|Q63151|ACSL3_RAT Long-chain-fatty-acid--CoA ligase 3 OS=Rattus norvegicus GN=Acsl3 PE=1 SV=1 49 693 8.0E-96
sp|Q9CZW4|ACSL3_MOUSE Long-chain-fatty-acid--CoA ligase 3 OS=Mus musculus GN=Acsl3 PE=1 SV=2 49 693 3.0E-95
sp|Q9SJD4|LACS8_ARATH Long chain acyl-CoA synthetase 8 OS=Arabidopsis thaliana GN=LACS8 PE=1 SV=1 42 693 2.0E-94
sp|O95573|ACSL3_HUMAN Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens GN=ACSL3 PE=1 SV=3 49 693 2.0E-93
sp|Q5R668|ACSL3_PONAB Long-chain-fatty-acid--CoA ligase 3 OS=Pongo abelii GN=ACSL3 PE=2 SV=2 49 693 8.0E-92
sp|Q9C7W4|LACS3_ARATH Long chain acyl-CoA synthetase 3 OS=Arabidopsis thaliana GN=LACS3 PE=2 SV=1 17 694 2.0E-88
sp|Q9XIA9|LACS2_ARATH Long chain acyl-CoA synthetase 2 OS=Arabidopsis thaliana GN=LACS2 PE=2 SV=1 27 693 2.0E-87
sp|Q9T0A0|LACS4_ARATH Long chain acyl-CoA synthetase 4 OS=Arabidopsis thaliana GN=LACS4 PE=2 SV=1 25 697 1.0E-86
sp|Q8LKS5|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 105 693 2.0E-86
sp|Q9CAP8|LACS9_ARATH Long chain acyl-CoA synthetase 9, chloroplastic OS=Arabidopsis thaliana GN=LACS9 PE=1 SV=1 98 693 3.0E-84
sp|Q9T009|LACS5_ARATH Long chain acyl-CoA synthetase 5 OS=Arabidopsis thaliana GN=LACS5 PE=2 SV=1 21 694 1.0E-83
sp|Q8LPS1|LACS6_ARATH Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana GN=LACS6 PE=1 SV=1 105 694 7.0E-82
sp|Q55DR6|FCSA_DICDI Fatty acyl-CoA synthetase A OS=Dictyostelium discoideum GN=fcsA PE=1 SV=1 107 693 3.0E-79
sp|O22898|LACS1_ARATH Long chain acyl-CoA synthetase 1 OS=Arabidopsis thaliana GN=LACS1 PE=2 SV=1 25 694 4.0E-78
sp|Q9JID6|ACSL1_CAVPO Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1 108 693 1.0E-76
sp|P41216|ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 108 693 2.0E-75
sp|P33121|ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens GN=ACSL1 PE=1 SV=1 108 693 2.0E-75
sp|P18163|ACSL1_RAT Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus GN=Acsl1 PE=1 SV=1 108 693 5.0E-75
sp|Q9ULC5|ACSL5_HUMAN Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens GN=ACSL5 PE=1 SV=1 108 694 4.0E-73
sp|O88813|ACSL5_RAT Long-chain-fatty-acid--CoA ligase 5 OS=Rattus norvegicus GN=Acsl5 PE=1 SV=1 108 694 2.0E-72
sp|Q8JZR0|ACSL5_MOUSE Long-chain-fatty-acid--CoA ligase 5 OS=Mus musculus GN=Acsl5 PE=1 SV=1 108 694 3.0E-72
sp|Q9UKU0|ACSL6_HUMAN Long-chain-fatty-acid--CoA ligase 6 OS=Homo sapiens GN=ACSL6 PE=2 SV=4 108 693 7.0E-63
sp|P33124|ACSL6_RAT Long-chain-fatty-acid--CoA ligase 6 OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 108 693 2.0E-62
sp|Q91WC3|ACSL6_MOUSE Long-chain-fatty-acid--CoA ligase 6 OS=Mus musculus GN=Acsl6 PE=1 SV=1 108 693 9.0E-62
sp|P39518|LCF2_YEAST Long-chain-fatty-acid--CoA ligase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA2 PE=1 SV=1 97 693 8.0E-47
sp|Q7TYX8|FAC15_MYCBO Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD15 PE=3 SV=2 115 694 2.0E-41
sp|B2HGV4|FAC15_MYCMM Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD15 PE=3 SV=1 115 693 2.0E-41
sp|O53521|FAC15_MYCTU Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD15 PE=1 SV=3 115 694 1.0E-40
sp|P16405|ORA_PLAFN Octapeptide-repeat antigen (Fragment) OS=Plasmodium falciparum (isolate NF7 / Ghana) PE=2 SV=1 220 694 1.0E-39
sp|Q9LK39|AAE16_ARATH Probable acyl-activating enzyme 16, chloroplastic OS=Arabidopsis thaliana GN=AAE16 PE=2 SV=1 111 694 3.0E-39
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 236 693 1.0E-38
sp|P44446|LCFH_HAEIN Putative long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0002 PE=3 SV=1 85 696 2.0E-38
sp|Q8W471|AAE15_ARATH Long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15, chloroplastic OS=Arabidopsis thaliana GN=AAE15 PE=1 SV=1 111 693 5.0E-37
sp|P9WQ53|FAD11_MYCTU Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD11 PE=3 SV=1 261 696 7.0E-36
sp|P9WQ52|FAD11_MYCTO Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD11 PE=3 SV=1 261 696 7.0E-36
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 257 693 1.0E-35
sp|Q9V3S9|BGM_DROME Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster GN=bgm PE=2 SV=1 108 693 6.0E-32
sp|Q2KHW5|ACBG1_BOVIN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Bos taurus GN=ACSBG1 PE=2 SV=1 52 564 1.0E-30
sp|A1L1K7|ACBG2_RAT Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Rattus norvegicus GN=Acsbg2 PE=2 SV=1 111 574 5.0E-30
sp|Q96GR2|ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens GN=ACSBG1 PE=2 SV=2 102 697 1.0E-29
sp|Q4R4P9|ACBG1_MACFA Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Macaca fascicularis GN=ACSBG1 PE=2 SV=2 103 697 3.0E-29
sp|Q5ZKR7|ACBG2_CHICK Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus GN=ACSBG2 PE=2 SV=2 18 697 3.0E-29
sp|Q2XU92|ACBG2_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus GN=Acsbg2 PE=1 SV=1 111 693 5.0E-29
sp|Q924N5|ACBG1_RAT Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus GN=Acsbg1 PE=1 SV=1 102 697 2.0E-28
sp|Q7ZYC4|ACBG2_XENLA Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopus laevis GN=acsbg2 PE=2 SV=1 111 694 4.0E-28
sp|Q99PU5|ACBG1_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Mus musculus GN=Acsbg1 PE=1 SV=1 102 697 1.0E-27
sp|Q5FVE4|ACBG2_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Homo sapiens GN=ACSBG2 PE=1 SV=2 108 693 3.0E-27
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 243 584 2.0E-26
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 245 572 7.0E-26
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 243 584 6.0E-25
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 258 598 2.0E-24
sp|Q9V3U0|BGML_DROME Long-chain-fatty-acid--CoA ligase bubblegum-like OS=Drosophila melanogaster GN=CG4500 PE=2 SV=1 111 584 3.0E-24
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 262 598 5.0E-24
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 266 572 7.0E-24
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 174 556 3.0E-23
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 174 556 3.0E-23
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 259 559 3.0E-23
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 243 584 5.0E-23
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 248 598 8.0E-23
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 112 603 2.0E-22
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 259 598 3.0E-22
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 261 556 4.0E-22
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 259 559 5.0E-22
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 245 618 6.0E-22
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 261 556 1.0E-21
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 261 556 1.0E-21
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 266 586 2.0E-21
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 136 604 3.0E-21
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 258 559 7.0E-21
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 110 572 1.0E-20
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 259 572 3.0E-20
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 259 598 3.0E-20
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 254 607 4.0E-20
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 102 598 9.0E-20
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 107 575 1.0E-19
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 266 598 2.0E-19
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 262 598 3.0E-19
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 262 556 4.0E-19
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 259 604 4.0E-19
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 259 598 1.0E-18
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 222 598 2.0E-18
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 107 572 3.0E-18
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 222 598 3.0E-18
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 255 604 3.0E-18
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 256 591 3.0E-18
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 259 625 3.0E-18
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 421 634 4.0E-18
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 107 572 4.0E-18
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 223 572 5.0E-18
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 421 572 7.0E-18
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 259 572 8.0E-18
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 264 570 8.0E-18
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 228 575 1.0E-17
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 111 572 1.0E-17
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 259 598 1.0E-17
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 231 634 3.0E-17
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 234 572 4.0E-17
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 246 565 5.0E-17
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 259 572 6.0E-17
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 262 598 6.0E-17
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 111 556 9.0E-17
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 262 598 1.0E-16
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 255 559 1.0E-16
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 264 602 2.0E-16
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 262 607 2.0E-16
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 249 602 2.0E-16
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 174 572 2.0E-16
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 228 634 4.0E-16
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 446 598 7.0E-16
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 238 601 8.0E-16
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 249 602 1.0E-15
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 249 602 1.0E-15
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 439 584 1.0E-15
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 249 602 1.0E-15
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 249 602 2.0E-15
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 249 602 2.0E-15
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 249 602 2.0E-15
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 266 598 2.0E-15
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 259 584 3.0E-15
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 147 584 3.0E-15
sp|Q00594|ALKK_PSEOL Medium-chain-fatty-acid--CoA ligase OS=Pseudomonas oleovorans GN=alkK PE=3 SV=1 174 598 7.0E-15
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 249 601 7.0E-15
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 445 598 8.0E-15
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 249 631 8.0E-15
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 258 536 1.0E-14
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 249 602 1.0E-14
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 257 572 2.0E-14
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 255 606 3.0E-14
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 258 572 3.0E-14
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 111 573 3.0E-14
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 249 602 7.0E-14
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 113 591 8.0E-14
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 261 591 1.0E-13
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 77 584 1.0E-13
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 249 602 1.0E-13
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 257 596 1.0E-13
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 261 572 1.0E-13
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 111 575 1.0E-13
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 264 584 1.0E-13
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 264 584 1.0E-13
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 258 551 3.0E-13
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 257 631 3.0E-13
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 257 631 3.0E-13
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 246 598 5.0E-13
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 257 631 5.0E-13
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 257 631 5.0E-13
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 257 631 6.0E-13
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 111 575 6.0E-13
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 257 584 7.0E-13
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 262 572 8.0E-13
sp|P31686|4CL1_SOYBN 4-coumarate--CoA ligase 1 (Fragment) OS=Glycine max PE=2 SV=1 421 598 8.0E-13
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 259 584 1.0E-12
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 257 631 1.0E-12
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 259 584 1.0E-12
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 259 584 1.0E-12
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 259 584 1.0E-12
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 259 584 1.0E-12
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 259 584 1.0E-12
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 230 556 1.0E-12
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 257 631 2.0E-12
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 77 575 2.0E-12
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 257 631 2.0E-12
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 257 631 2.0E-12
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 257 631 2.0E-12
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 419 572 2.0E-12
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 257 631 2.0E-12
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 257 631 2.0E-12
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 257 631 2.0E-12
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 259 591 3.0E-12
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 259 584 4.0E-12
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 259 584 4.0E-12
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 262 554 6.0E-12
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 261 622 7.0E-12
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 127 600 8.0E-12
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 219 596 8.0E-12
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 219 596 8.0E-12
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 259 584 1.0E-11
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 261 555 2.0E-11
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 259 584 2.0E-11
sp|Q5HNB2|MENE_STAEQ 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 261 584 3.0E-11
sp|Q9LQ12|4CLL1_ARATH 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 266 584 3.0E-11
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 261 592 4.0E-11
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 447 622 4.0E-11
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 386 631 6.0E-11
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 421 572 6.0E-11
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 249 572 6.0E-11
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 252 572 7.0E-11
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 446 604 8.0E-11
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 386 631 9.0E-11
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 245 570 1.0E-10
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 444 585 1.0E-10
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 386 631 1.0E-10
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 109 556 1.0E-10
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 420 572 1.0E-10
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 386 631 1.0E-10
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 261 572 2.0E-10
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 386 631 2.0E-10
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 386 631 2.0E-10
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 420 572 2.0E-10
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 386 631 2.0E-10
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 386 631 2.0E-10
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 386 631 2.0E-10
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 386 631 2.0E-10
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 386 631 2.0E-10
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 386 596 3.0E-10
sp|Q8CS21|MENE_STAES 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menE PE=3 SV=1 261 584 3.0E-10
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 386 631 4.0E-10
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 447 622 4.0E-10
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 261 586 4.0E-10
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 419 603 5.0E-10
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 386 596 5.0E-10
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 420 572 6.0E-10
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 386 596 6.0E-10
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 386 596 6.0E-10
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 420 572 6.0E-10
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 420 572 6.0E-10
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 420 572 6.0E-10
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 420 572 6.0E-10
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 420 572 6.0E-10
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 420 633 6.0E-10
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 420 633 6.0E-10
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 386 596 6.0E-10
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 420 572 6.0E-10
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 420 572 6.0E-10
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 420 572 6.0E-10
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 386 596 7.0E-10
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 420 572 7.0E-10
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 420 572 7.0E-10
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 420 572 7.0E-10
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 420 572 7.0E-10
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 420 572 7.0E-10
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 420 572 7.0E-10
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 420 572 7.0E-10
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 420 572 7.0E-10
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 420 572 7.0E-10
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 420 572 7.0E-10
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 446 634 7.0E-10
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 420 633 7.0E-10
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 420 572 7.0E-10
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 447 586 7.0E-10
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 420 572 7.0E-10
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 420 572 7.0E-10
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 420 572 7.0E-10
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 420 572 8.0E-10
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 420 572 8.0E-10
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 420 572 8.0E-10
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 420 572 8.0E-10
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 420 572 8.0E-10
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 420 572 8.0E-10
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 420 572 8.0E-10
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 386 631 9.0E-10
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 439 586 1.0E-09
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 259 601 1.0E-09
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 245 586 1.0E-09
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 446 634 1.0E-09
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 237 593 1.0E-09
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 92 589 1.0E-09
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 420 572 1.0E-09
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 386 631 1.0E-09
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 386 631 1.0E-09
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 386 631 1.0E-09
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 419 572 2.0E-09
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 419 572 2.0E-09
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 419 572 2.0E-09
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 419 572 2.0E-09
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 419 572 2.0E-09
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 419 572 2.0E-09
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 419 572 2.0E-09
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 419 572 2.0E-09
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 386 631 2.0E-09
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 262 586 2.0E-09
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 76 634 2.0E-09
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 261 622 2.0E-09
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 261 618 2.0E-09
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 420 633 3.0E-09
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 420 572 3.0E-09
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 420 572 3.0E-09
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 420 572 3.0E-09
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 420 572 4.0E-09
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 259 571 4.0E-09
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 420 633 4.0E-09
sp|Q7N7A9|AAS_PHOLL Bifunctional protein Aas OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aas PE=3 SV=1 419 557 5.0E-09
sp|Q7F1X5|4CLL5_ORYSJ 4-coumarate--CoA ligase-like 5 OS=Oryza sativa subsp. japonica GN=4CLL5 PE=2 SV=1 262 598 5.0E-09
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 197 584 6.0E-09
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 419 572 8.0E-09
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 262 584 8.0E-09
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 421 588 1.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 419 623 2.0E-08
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 235 591 3.0E-08
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 261 609 3.0E-08
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 261 586 3.0E-08
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 262 584 5.0E-08
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 261 589 5.0E-08
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 261 571 5.0E-08
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 450 622 7.0E-08
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 259 555 7.0E-08
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 450 622 8.0E-08
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 266 572 8.0E-08
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 261 590 9.0E-08
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 259 584 1.0E-07
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 448 589 1.0E-07
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 427 584 1.0E-07
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 448 634 1.0E-07
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 253 598 2.0E-07
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 264 586 2.0E-07
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 500 586 2.0E-07
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 421 586 3.0E-07
sp|Q9SS01|AAE20_ARATH Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 266 572 3.0E-07
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 448 586 5.0E-07
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 261 596 7.0E-07
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 500 595 1.0E-06
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 261 593 1.0E-06
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 467 605 1.0E-06
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 264 605 1.0E-06
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 446 599 2.0E-06
sp|Q9C9G2|AEE22_ARATH Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 439 598 2.0E-06
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 472 605 2.0E-06
sp|Q9CHK3|MENE_LACLA 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 392 591 2.0E-06
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 261 593 2.0E-06
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 500 589 2.0E-06
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 261 592 3.0E-06
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 264 581 3.0E-06
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 264 609 4.0E-06
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 450 586 8.0E-06
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 411 593 8.0E-06
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 446 688 9.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1441
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|064950 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|552300
Agaricus bisporus var bisporus H97 AgabiH97|038100
Agaricus bisporus var bisporus H97 AgabiH97|064950
Rhodonia placenta FPRL280 RhoplFPRL280|122_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|064950
MYHPPRPLQLRPEYFGKGTVDVAPAKPNEGPVRRLAVTSNTFVERPAEGIDTTSDIVSYAAKKYGKLKAIGWRDT
IKIHEEQKEVKKIVNGSETTQTKTWKFFELSDYKYLNYMELEEAISHAGRGLASLGITPDHVFNIYASTGPYWQI
ISQGCALISTPIATAYDTLGEAGLEHSLTEPESIGLFTDSDLLPTVLKVLPRTPTVKFVVYGGSPKNGIIQQIQS
IRDGAIRTIHVDELLAIGKDIDVATIQDRRPTKDVIACIMYTSGTTDAPKGVCLSHSSLVASVASVHFMLEPHFS
PGDRYLAYLPLAHVLEYVVEIAAMFLGLTTGFARSKTLMDNSVRNCRGDLPSFKPNIMVGVPTVWETMKKGIISK
INESGWLVWGAFWGAMMLKSARIPMLDSLADRFVLGSSRNVVGGQLRFALSGSASLNEETQDFLSKAVGPLMQAY
GMTETSGMCSVLPPELYRTGSVGLPAPSVEVKFIDIPEAGYSSRNNPPTGEICIRGPSLSKGYFKRPDLNSDETI
FAKDGWFRTGDVGQWNEDGTISLIDRIKNLIKLQHGEYIALERLESIYKSCELVSNICVYASAEAKQPLAIIVPH
GHNLRHALSSMKSAPSPSTSLPELCEDKTVKNMILDECNAMGKHCGLRQVEALCDVILTPEEWTPENGLLTAAQK
LQRSKISKAFQGEIDMVYKGQN*
Coding >AgabiH39|064950
ATGTATCACCCACCTAGACCCCTGCAACTACGCCCTGAATACTTTGGCAAAGGCACCGTCGACGTTGCGCCGGCC
AAACCCAACGAGGGACCTGTCCGTAGACTTGCTGTAACATCCAACACATTCGTCGAAAGGCCCGCAGAAGGCATT
GACACGACCTCTGACATCGTCTCCTACGCTGCAAAAAAGTACGGAAAGCTGAAAGCCATAGGATGGCGGGACACC
ATCAAAATCCATGAGGAACAGAAGGAAGTCAAGAAAATCGTCAATGGAAGTGAAACCACACAGACGAAAACGTGG
AAGTTTTTCGAGCTCAGCGACTACAAGTATCTCAATTACATGGAGCTAGAGGAGGCCATCTCTCACGCAGGACGT
GGTCTAGCGAGCTTGGGGATCACCCCCGACCACGTCTTCAACATTTACGCCTCGACTGGGCCGTATTGGCAAATC
ATATCGCAGGGCTGCGCCCTTATATCAACTCCTATCGCGACGGCATACGACACGCTTGGCGAGGCTGGCCTCGAA
CATTCGCTAACCGAGCCCGAGTCCATCGGTCTATTCACTGATTCTGATCTCCTCCCCACTGTCCTCAAAGTTCTT
CCTCGCACTCCCACTGTCAAGTTCGTCGTCTACGGCGGCTCGCCTAAAAATGGCATCATCCAACAAATACAGTCT
ATCCGCGACGGCGCCATCAGAACAATCCATGTCGACGAACTGCTGGCTATCGGCAAAGACATTGATGTCGCGACA
ATTCAAGACCGCCGCCCTACAAAGGACGTGATAGCTTGTATAATGTACACAAGTGGTACTACTGATGCCCCCAAG
GGCGTTTGCCTTTCACATAGCAGCCTCGTTGCCTCCGTTGCCTCAGTCCACTTTATGCTCGAACCTCACTTTTCC
CCCGGTGACAGATATCTTGCCTATCTCCCTCTCGCCCACGTACTCGAATACGTTGTTGAAATCGCTGCGATGTTT
TTGGGTCTCACTACGGGATTTGCGCGTTCGAAAACTCTCATGGACAACTCAGTCAGGAATTGCAGAGGCGATTTG
CCGAGTTTCAAACCGAATATTATGGTCGGTGTTCCAACTGTATGGGAAACGATGAAGAAAGGGATCATCAGCAAG
ATTAACGAGTCTGGGTGGCTCGTCTGGGGAGCTTTCTGGGGCGCGATGATGTTGAAGAGTGCTAGAATACCTATG
TTGGACAGCCTCGCGGATAGATTTGTCCTTGGATCAAGTCGAAATGTCGTAGGCGGTCAATTGCGATTTGCTCTT
AGCGGGAGCGCATCTCTTAATGAGGAGACGCAAGATTTTTTGAGCAAGGCCGTAGGACCTTTAATGCAAGCATAT
GGAATGACCGAAACTTCCGGAATGTGTAGTGTTCTTCCGCCAGAGCTGTATCGAACCGGTTCTGTTGGGCTCCCG
GCTCCCTCGGTAGAAGTCAAATTTATAGACATACCGGAGGCGGGGTACTCTTCTCGAAACAATCCACCCACCGGT
GAGATCTGCATTCGAGGACCATCGCTCTCGAAAGGATATTTCAAGAGACCGGACTTGAACTCGGATGAGACGATC
TTCGCGAAAGACGGGTGGTTTAGGACAGGCGATGTCGGACAATGGAATGAAGATGGTACTATTTCACTCATCGAT
CGCATCAAGAATTTAATCAAGTTACAGCACGGAGAATATATTGCTCTGGAGCGGCTTGAGTCGATCTACAAGTCT
TGTGAACTCGTGTCCAATATCTGTGTATACGCTTCTGCGGAAGCGAAGCAGCCCCTCGCAATTATTGTTCCGCAC
GGCCATAATCTCAGACATGCGCTATCGTCCATGAAATCTGCTCCATCCCCTTCGACGTCTCTGCCGGAATTATGT
GAAGACAAGACGGTCAAGAATATGATATTGGATGAATGCAATGCGATGGGAAAGCATTGTGGATTGCGACAGGTT
GAGGCTTTATGTGATGTCATTCTGACACCGGAGGAGTGGACGCCGGAGAATGGGTTGTTGACGGCTGCGCAAAAA
CTTCAGCGGTCAAAGATTTCGAAGGCGTTCCAGGGCGAGATTGATATGGTTTACAAGGGCCAGAATTAG
Transcript >AgabiH39|064950
ATGTATCACCCACCTAGACCCCTGCAACTACGCCCTGAATACTTTGGCAAAGGCACCGTCGACGTTGCGCCGGCC
AAACCCAACGAGGGACCTGTCCGTAGACTTGCTGTAACATCCAACACATTCGTCGAAAGGCCCGCAGAAGGCATT
GACACGACCTCTGACATCGTCTCCTACGCTGCAAAAAAGTACGGAAAGCTGAAAGCCATAGGATGGCGGGACACC
ATCAAAATCCATGAGGAACAGAAGGAAGTCAAGAAAATCGTCAATGGAAGTGAAACCACACAGACGAAAACGTGG
AAGTTTTTCGAGCTCAGCGACTACAAGTATCTCAATTACATGGAGCTAGAGGAGGCCATCTCTCACGCAGGACGT
GGTCTAGCGAGCTTGGGGATCACCCCCGACCACGTCTTCAACATTTACGCCTCGACTGGGCCGTATTGGCAAATC
ATATCGCAGGGCTGCGCCCTTATATCAACTCCTATCGCGACGGCATACGACACGCTTGGCGAGGCTGGCCTCGAA
CATTCGCTAACCGAGCCCGAGTCCATCGGTCTATTCACTGATTCTGATCTCCTCCCCACTGTCCTCAAAGTTCTT
CCTCGCACTCCCACTGTCAAGTTCGTCGTCTACGGCGGCTCGCCTAAAAATGGCATCATCCAACAAATACAGTCT
ATCCGCGACGGCGCCATCAGAACAATCCATGTCGACGAACTGCTGGCTATCGGCAAAGACATTGATGTCGCGACA
ATTCAAGACCGCCGCCCTACAAAGGACGTGATAGCTTGTATAATGTACACAAGTGGTACTACTGATGCCCCCAAG
GGCGTTTGCCTTTCACATAGCAGCCTCGTTGCCTCCGTTGCCTCAGTCCACTTTATGCTCGAACCTCACTTTTCC
CCCGGTGACAGATATCTTGCCTATCTCCCTCTCGCCCACGTACTCGAATACGTTGTTGAAATCGCTGCGATGTTT
TTGGGTCTCACTACGGGATTTGCGCGTTCGAAAACTCTCATGGACAACTCAGTCAGGAATTGCAGAGGCGATTTG
CCGAGTTTCAAACCGAATATTATGGTCGGTGTTCCAACTGTATGGGAAACGATGAAGAAAGGGATCATCAGCAAG
ATTAACGAGTCTGGGTGGCTCGTCTGGGGAGCTTTCTGGGGCGCGATGATGTTGAAGAGTGCTAGAATACCTATG
TTGGACAGCCTCGCGGATAGATTTGTCCTTGGATCAAGTCGAAATGTCGTAGGCGGTCAATTGCGATTTGCTCTT
AGCGGGAGCGCATCTCTTAATGAGGAGACGCAAGATTTTTTGAGCAAGGCCGTAGGACCTTTAATGCAAGCATAT
GGAATGACCGAAACTTCCGGAATGTGTAGTGTTCTTCCGCCAGAGCTGTATCGAACCGGTTCTGTTGGGCTCCCG
GCTCCCTCGGTAGAAGTCAAATTTATAGACATACCGGAGGCGGGGTACTCTTCTCGAAACAATCCACCCACCGGT
GAGATCTGCATTCGAGGACCATCGCTCTCGAAAGGATATTTCAAGAGACCGGACTTGAACTCGGATGAGACGATC
TTCGCGAAAGACGGGTGGTTTAGGACAGGCGATGTCGGACAATGGAATGAAGATGGTACTATTTCACTCATCGAT
CGCATCAAGAATTTAATCAAGTTACAGCACGGAGAATATATTGCTCTGGAGCGGCTTGAGTCGATCTACAAGTCT
TGTGAACTCGTGTCCAATATCTGTGTATACGCTTCTGCGGAAGCGAAGCAGCCCCTCGCAATTATTGTTCCGCAC
GGCCATAATCTCAGACATGCGCTATCGTCCATGAAATCTGCTCCATCCCCTTCGACGTCTCTGCCGGAATTATGT
GAAGACAAGACGGTCAAGAATATGATATTGGATGAATGCAATGCGATGGGAAAGCATTGTGGATTGCGACAGGTT
GAGGCTTTATGTGATGTCATTCTGACACCGGAGGAGTGGACGCCGGAGAATGGGTTGTTGACGGCTGCGCAAAAA
CTTCAGCGGTCAAAGATTTCGAAGGCGTTCCAGGGCGAGATTGATATGGTTTACAAGGGCCAGAATTAG
Gene >AgabiH39|064950
ATGTATCACCCACCTAGACCCCTGCAACTACGCCCTGAATACTTTGGCAAAGGCACCGTCGACGTTGCGCCGGCC
AAACCCAACGAGGGACCTGTCCGTAGACTTGCTGTAACATCCAACACATTCGTCGAAAGGCCCGCAGAAGGCATT
GACACGACCTCTGACATCGTCTCCTACGCTGCAAAAAAGTACGGAAAGCTGAAAGCCATAGGATGGCGGGACACC
ATCAAAATCCATGAGGAACAGAAGGAAGTCAAGAAAATCGTCAATGGAAGTGAAACCACACAGACGAAAACGTGG
AAGTTTTTCGAGCTCAGCGACTACAAGTATCTCAATTACATGGAGCTAGAGGAGGCCATCTCTCACGCAGGACGT
GGTCTAGCGAGCTTGGGGATCACCCCCGACCACGTCTTCAACATTTACGCCTCGACTGGGTTAGTATCACCCATC
CTCTACGTTTGGCTGTGTTGACTTTATTCCAGGCCGTATTGGCAAATCATATCGCAGGGCTGCGCCCTTATATCA
ACTCCTATCGCGACGGCATACGACACGCTTGGCGAGGCTGGCCTCGAACATTCGCTAACCGAGCCCGAGTCCATC
GGTCTATTCACTGATTCTGATCTCCTCCCCACTGTCCTCAAAGTTCTTCCTCGCACTCCCACTGTCAAGTTCGTC
GTCTACGGCGGCTCGCCTAAAAATGGCATCATCCAACAAATACAGTCTATCCGCGACGGCGCCATCAGAACAATC
CATGTCGACGAACTGCTGGCTATCGGCAAAGACATTGATGTCGCGACAATTCAAGACCGCCGCCCTACAAAGGAC
GTGATAGCTTGTATAATGTACACAAGTGGTACTACTGATGCCCCCAAGGGCGTTTGCCTTTCACATAGCAGCCTC
GTTGCCTCCGTTGCCTCAGTCCACTTTATGCTCGAACCTCACTTTTCCCCCGGTGACAGATATCTTGCCTATCTC
CCTCTCGCCCACGTACTCGAATACGTTGTTGAAATCGCTGCGATGTTTTTGGGTCTCACTACGGGATTTGCGCGT
TCGAAAACTCTCATGGACAACTCAGTCAGGAATTGCAGAGGCGATTTGCCGAGTTTCAAACCGAATATTATGGTC
GGTGTTCCAACTGTATGGGAAACGATGAAGAAAGGGATCATCAGCAAGATTAACGAGTCTGGGTGGCTCGTCTGG
GGAGCTTTCTGGGGCGCGATGATGTTGAAGAGTGCTAGAATACCTATGTTGGACAGCCTCGCGGATAGATTTGTC
CTTGGATCAAGTCGAAATGTCGTAGGCGGTCAATTGCGATTTGCTCTTAGCGGGAGCGCATCTCTTAATGAGGAG
ACGCAAGATTTTTTGAGCAAGGCCGTAGGACCTTTAATGCAAGGTGTGTCTCATTTCTTCCTCTCTCGTCATGGT
CAACCGCTACATTCATATTGAATGGTTTATGTAGCATATGGAATGACCGAAACTTCCGGAATGTGTAGTGTTCTT
CCGCCAGAGCTGTATCGAACCGGTTCTGTTGGGCTCCCGGCTCCCTCGGTAGAAGTCAAATTTATAGACATACCG
GAGGCGGGGTACTCTTCTCGAAACAATCCACCCACCGGTGAGATCTGCATTCGAGGACCATCGCTCTCGAAAGGA
TATTTCAAGAGACCGGACTTGAACTCGGATGAGACGATCTTCGCGAAAGACGGGTGGTTTAGGACAGGCGATGTC
GGACAATGGAATGAAGATGGTACTATTTCACTCATCGATCGGTGCGCCTTGTTTTTTATTTTTATCCGTTTTTTG
TAATTGATACATCGTTTGCTATAGCATCAAGAATTTAATCAAGTTACAGCACGGAGAATATATTGCTCTGGAGCG
GCTTGAGTCGATCTACAAGTCTTGTGAACTCGTGTCCAATATCTGTGTATACGCTTCTGCGGAAGCGAAGCAGCC
CCTCGCAATTATTGTTCCGCACGGCCATAATCTCAGACATGCGCTATCGTCCATGAAATCTGCTCCATCCCCTTC
GACGTCTCTGCCGGAATTATGTGAAGACAAGACGGTCAAGAATATGATATTGGATGAATGCAATGCGATGGGAAA
GCATTGTGGATTGCGACAGGTTGAGGCTTTATGTGATGTCATTCTGACACCGGAGGAGTGGACGCCGGAGAATGG
GTTGTTGACGGCTGCGCAAAAACTTCAGCGGTCAAAGATTTCGAAGGCGTTCCAGGGCGAGATTGATGTGAGTGT
TTTTTTTTTCATATTGTTGTTATTGTATTGAAGGGCGTTTAGATGGTTTACAAGGGCCAGAATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail