Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|062950
Gene name
Locationscaffold_03:2419152..2420117
Strand-
Gene length (bp)965
Transcript length (bp)861
Coding sequence length (bp)861
Protein length (aa) 287

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 1.6E-10 58 152
PF13489 Methyltransf_23 Methyltransferase domain 2.5E-09 33 206
PF08241 Methyltransf_11 Methyltransferase domain 4.1E-07 59 154
PF13847 Methyltransf_31 Methyltransferase domain 2.2E-06 57 173
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 6.6E-05 55 162

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup288
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|023670
Agaricus bisporus var bisporus H39 AgabiH39|030510
Agaricus bisporus var bisporus H39 AgabiH39|062930
Agaricus bisporus var bisporus H39 AgabiH39|062940
Agaricus bisporus var bisporus H39 AgabiH39|062950 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|062970
Agaricus bisporus var bisporus H39 AgabiH39|062990
Agaricus bisporus var bisporus H39 AgabiH39|069420
Agaricus bisporus var bisporus H39 AgabiH39|294900
Agaricus bisporus var bisporus H39 AgabiH39|387000
Agaricus bisporus var bisporus H97 AgabiH97|069430
Agaricus bisporus var bisporus H97 AgabiH97|069420
Agaricus bisporus var bisporus H97 AgabiH97|062990
Agaricus bisporus var bisporus H97 AgabiH97|062970
Agaricus bisporus var bisporus H97 AgabiH97|062960
Agaricus bisporus var bisporus H97 AgabiH97|023670
Agaricus bisporus var bisporus H97 AgabiH97|062940
Agaricus bisporus var bisporus H97 AgabiH97|062930
Agaricus bisporus var bisporus H97 AgabiH97|030510
Agaricus bisporus var bisporus H97 AgabiH97|096710
Agaricus bisporus var bisporus H97 AgabiH97|062950
Rhodonia placenta FPRL280 RhoplFPRL280|71_4

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|062950
MSAIEHVVKRDYIDGSVYALPHDQAEHPRLLMQHNLFLRVLDHKILHAPVELQDDDWVLETATGTGIWLQDLAKV
TSTKPQYIGVDIESNLFPQASTLPKNISFETQSVLDLPKEWTNKFTLVHQRLIISGLRRHEWEQDIKELYRVVKP
GGWVQLFELRIWTSGPALAKHWDLLCKFADDVGLMFRDIATKLPDFLKQSGFVDIHEDTCDTPLGAWANRDGDDG
KKNLMGLLQGLKTPILRGGGYGVVGSEAEYDELLEEIEKEVDMTPGSTALWTMFWARKPSE*
Coding >AgabiH39|062950
ATGTCCGCTATTGAACACGTCGTAAAACGAGACTACATTGATGGCTCGGTGTATGCTCTGCCACACGACCAAGCA
GAGCATCCGAGATTGTTAATGCAGCATAATTTATTCCTCCGGGTCCTCGACCACAAGATCCTCCATGCGCCGGTC
GAGCTACAAGATGATGATTGGGTCTTGGAAACAGCTACTGGTACAGGTATCTGGCTTCAAGACTTGGCTAAAGTA
ACATCCACGAAGCCACAGTACATCGGTGTTGATATCGAATCAAATTTATTCCCACAAGCGTCAACTCTCCCCAAA
AACATCAGTTTTGAAACCCAATCCGTTCTCGACCTTCCCAAGGAATGGACAAACAAGTTCACATTGGTTCATCAA
CGTCTTATCATCTCGGGTCTCCGCAGACATGAATGGGAACAAGATATAAAAGAATTGTATCGGGTTGTTAAACCT
GGTGGATGGGTTCAATTGTTCGAGCTGCGGATATGGACTTCTGGTCCAGCCCTTGCCAAACATTGGGATTTGCTT
TGCAAGTTCGCAGATGATGTGGGGTTGATGTTTCGTGATATCGCCACCAAACTACCAGATTTTCTCAAACAAAGT
GGTTTTGTTGATATTCATGAGGACACTTGTGATACCCCTCTTGGTGCTTGGGCAAATCGGGACGGTGATGATGGT
AAAAAGAATCTAATGGGGCTTTTGCAAGGACTCAAGACACCAATATTGAGAGGAGGCGGGTACGGCGTGGTGGGA
AGCGAGGCGGAATACGATGAACTTCTGGAGGAGATTGAGAAGGAAGTGGATATGACGCCTGGATCGACAGCTTTG
TGGACAATGTTCTGGGCACGGAAACCATCTGAGTAG
Transcript >AgabiH39|062950
ATGTCCGCTATTGAACACGTCGTAAAACGAGACTACATTGATGGCTCGGTGTATGCTCTGCCACACGACCAAGCA
GAGCATCCGAGATTGTTAATGCAGCATAATTTATTCCTCCGGGTCCTCGACCACAAGATCCTCCATGCGCCGGTC
GAGCTACAAGATGATGATTGGGTCTTGGAAACAGCTACTGGTACAGGTATCTGGCTTCAAGACTTGGCTAAAGTA
ACATCCACGAAGCCACAGTACATCGGTGTTGATATCGAATCAAATTTATTCCCACAAGCGTCAACTCTCCCCAAA
AACATCAGTTTTGAAACCCAATCCGTTCTCGACCTTCCCAAGGAATGGACAAACAAGTTCACATTGGTTCATCAA
CGTCTTATCATCTCGGGTCTCCGCAGACATGAATGGGAACAAGATATAAAAGAATTGTATCGGGTTGTTAAACCT
GGTGGATGGGTTCAATTGTTCGAGCTGCGGATATGGACTTCTGGTCCAGCCCTTGCCAAACATTGGGATTTGCTT
TGCAAGTTCGCAGATGATGTGGGGTTGATGTTTCGTGATATCGCCACCAAACTACCAGATTTTCTCAAACAAAGT
GGTTTTGTTGATATTCATGAGGACACTTGTGATACCCCTCTTGGTGCTTGGGCAAATCGGGACGGTGATGATGGT
AAAAAGAATCTAATGGGGCTTTTGCAAGGACTCAAGACACCAATATTGAGAGGAGGCGGGTACGGCGTGGTGGGA
AGCGAGGCGGAATACGATGAACTTCTGGAGGAGATTGAGAAGGAAGTGGATATGACGCCTGGATCGACAGCTTTG
TGGACAATGTTCTGGGCACGGAAACCATCTGAGTAG
Gene >AgabiH39|062950
ATGTCCGCTATTGAACACGTCGTAAAACGAGACTACATTGATGGCTCGGTGTATGCTCTGCCACACGACCAAGCA
GAGCATCCGAGGTGAGATTTCAGCCTGCGATTGCTCTTCACTGAAATGTATCGATACTATTAGATTGTTAATGCA
GCATAATTTATTCCTCCGGGTCCTCGACCACAAGATCCTCCATGCGCCGGTCGAGCTACAAGATGATGATTGGGT
CTTGGAAACAGCTACTGGTACAGGTATGTGCTCTCTTGAGCTGGAAGAAGCAAATTACTCAGTAGGCTTCGTAAG
GTATCTGGCTTCAAGACTTGGCTAAAGTAACATCCACGAAGCCACAGTACATCGGTGTTGATATCGAATCAAATT
TATTCCCACAAGCGTCAACTCTCCCCAAAAACATCAGTTTTGAAACCCAATCCGTTCTCGACCTTCCCAAGGAAT
GGACAAACAAGTTCACATTGGTTCATCAACGTCTTATCATCTCGGGTCTCCGCAGACATGAATGGGAACAAGATA
TAAAAGAATTGTATCGGGTTGTTAAACCTGGTGGATGGGTTCAATTGTTCGAGCTGCGGATATGGACTTCTGGTC
CAGCCCTTGCCAAACATTGGGATTTGCTTTGCAAGTTCGCAGATGATGTGGGGTTGATGTTTCGTGATATCGCCA
CCAAACTACCAGATTTTCTCAAACAAAGTGGTTTTGTTGATATTCATGAGGACACTTGTGATACCCCTCTTGGTG
CTTGGGCAAATCGGGACGGTGATGATGGTAAAAAGAATCTAATGGGGCTTTTGCAAGGACTCAAGACACCAATAT
TGAGAGGAGGCGGGTACGGCGTGGTGGGAAGCGAGGCGGAATACGATGAACTTCTGGAGGAGATTGAGAAGGAAG
TGGATATGACGCCTGGATCGACAGCTTTGTGGACAATGTTCTGGGCACGGAAACCATCTGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail