Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|061010
Gene name
Locationscaffold_03:1919785..1921805
Strand-
Gene length (bp)2020
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 6.3E-20 102 569

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O88813|ACSL5_RAT Long-chain-fatty-acid--CoA ligase 5 OS=Rattus norvegicus GN=Acsl5 PE=1 SV=1 106 571 5.0E-14
sp|Q8JZR0|ACSL5_MOUSE Long-chain-fatty-acid--CoA ligase 5 OS=Mus musculus GN=Acsl5 PE=1 SV=1 106 571 9.0E-14
sp|P41216|ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 112 571 2.0E-13
sp|P18163|ACSL1_RAT Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus GN=Acsl1 PE=1 SV=1 112 571 3.0E-13
sp|Q8LKS5|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 55 571 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O88813|ACSL5_RAT Long-chain-fatty-acid--CoA ligase 5 OS=Rattus norvegicus GN=Acsl5 PE=1 SV=1 106 571 5.0E-14
sp|Q8JZR0|ACSL5_MOUSE Long-chain-fatty-acid--CoA ligase 5 OS=Mus musculus GN=Acsl5 PE=1 SV=1 106 571 9.0E-14
sp|P41216|ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 112 571 2.0E-13
sp|P18163|ACSL1_RAT Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus GN=Acsl1 PE=1 SV=1 112 571 3.0E-13
sp|Q8LKS5|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 55 571 2.0E-12
sp|Q55DR6|FCSA_DICDI Fatty acyl-CoA synthetase A OS=Dictyostelium discoideum GN=fcsA PE=1 SV=1 109 571 5.0E-12
sp|Q9ULC5|ACSL5_HUMAN Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens GN=ACSL5 PE=1 SV=1 106 571 2.0E-11
sp|P33121|ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens GN=ACSL1 PE=1 SV=1 112 571 3.0E-11
sp|Q9JID6|ACSL1_CAVPO Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1 106 571 1.0E-10
sp|Q8LPS1|LACS6_ARATH Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana GN=LACS6 PE=1 SV=1 53 571 6.0E-10
sp|Q9T009|LACS5_ARATH Long chain acyl-CoA synthetase 5 OS=Arabidopsis thaliana GN=LACS5 PE=2 SV=1 91 571 2.0E-09
sp|Q91WC3|ACSL6_MOUSE Long-chain-fatty-acid--CoA ligase 6 OS=Mus musculus GN=Acsl6 PE=1 SV=1 109 571 5.0E-09
sp|Q9C7W4|LACS3_ARATH Long chain acyl-CoA synthetase 3 OS=Arabidopsis thaliana GN=LACS3 PE=2 SV=1 89 571 4.0E-07
sp|Q9QUJ7|ACSL4_MOUSE Long-chain-fatty-acid--CoA ligase 4 OS=Mus musculus GN=Acsl4 PE=1 SV=2 109 571 5.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 13 31 18

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup4093
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|061010 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|061010
Rhodonia placenta FPRL280 RhoplFPRL280|3_129

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|061010
MFNISDYVVTDDLTILLALIAATTFLLNNLYKPQPLVHPILLGRQSDVGRARNPGESAVYRNYGTGLMGRFPVRP
SKEIAILPHLIKPESEASRTLWATRGTNAGLQDRIAALGSGLIRLAGLKPGESKVLLLLNDGIEFIIADFALATH
SVISVTLNSQDLLKRVLESQSFSAIIASPEIVPRVLETIYASSFNSRPHTIVIAGDVSQQTLASVASNIKILKFN
EVEREGIKVDKLVSKLPEPSDIYTMTYLSNEAGQLQVAQLTHENATAGVAATRSLLPISHALSPLDTIISAFSLS
TAYGRVIAYTAIYEGASFATLPSSKMYHDEQPAAPADASDILAAKRYPIPSPTIMFIQPGHLIAIVTDILKNAAG
SMFLFPFARRHKLAGISDGFITRESLWDRLVFDGARAKVIGDGAATLRGVIVSGRSLPAVLMTPARMALSVPLVN
TFTHPLVAGPVLASHPFDLQDFTEEGVSSDKKGHVGPPSVNVEAKLTGVDDEKVENGGDPAGLLFVRGPPVGKIG
NGDQNEDYVQVSPTEERRVRDENAEEGWISTGVRAQVQPNGSFIVL*
Coding >AgabiH39|061010
ATGTTCAATATATCCGACTACGTGGTCACCGACGACCTCACCATCCTCCTCGCCCTCATAGCGGCGACCACTTTT
CTCCTCAATAACCTCTACAAGCCTCAGCCACTGGTGCACCCCATATTGCTCGGCAGGCAGAGTGATGTCGGACGC
GCGCGTAATCCAGGAGAGAGTGCTGTCTATAGGAACTATGGAACTGGATTAATGGGCAGGTTTCCTGTGCGTCCC
AGCAAGGAGATTGCAATCCTACCACACCTTATTAAGCCGGAATCCGAGGCATCTCGTACCCTTTGGGCCACAAGG
GGAACCAACGCTGGCCTGCAAGATCGCATTGCCGCTCTGGGCAGCGGTCTCATCCGTCTTGCTGGTTTGAAGCCA
GGCGAGTCAAAGGTCCTTCTGCTCTTGAATGACGGAATCGAATTTATCATCGCCGATTTTGCACTTGCAACGCAT
TCCGTCATCTCCGTCACACTCAACTCTCAGGATCTATTGAAGCGGGTTTTGGAATCGCAGTCATTTTCTGCTATT
ATTGCCTCGCCAGAAATTGTTCCCCGCGTTCTTGAGACCATTTATGCCTCCAGTTTTAATTCCCGCCCTCATACT
ATCGTCATTGCTGGAGATGTCAGTCAACAGACTTTGGCTAGTGTCGCGAGCAACATCAAGATTCTCAAATTTAAC
GAGGTTGAACGGGAGGGAATCAAAGTTGACAAACTCGTTAGCAAACTTCCTGAACCCTCTGATATATATACTATG
ACCTACCTTTCCAATGAGGCTGGTCAGTTGCAGGTCGCGCAGTTGACTCATGAAAACGCGACTGCCGGGGTTGCT
GCCACCCGCAGTTTACTCCCAATTTCTCATGCCTTGTCACCTCTGGATACAATCATCTCGGCTTTTTCGCTTAGC
ACAGCTTACGGAAGAGTTATTGCATATACCGCCATTTATGAAGGAGCGAGTTTCGCGACGTTGCCTAGCTCGAAA
ATGTATCATGATGAACAGCCCGCAGCTCCTGCTGATGCTTCTGATATCTTAGCAGCCAAGAGATATCCCATTCCC
TCTCCGACGATCATGTTTATCCAACCTGGACATCTTATTGCCATTGTGACCGATATTTTGAAAAACGCCGCCGGA
TCAATGTTTTTGTTTCCGTTTGCAAGGAGGCACAAACTTGCAGGCATCAGCGACGGGTTTATCACAAGGGAGAGT
CTGTGGGATAGATTGGTCTTTGATGGAGCTCGCGCGAAAGTAATTGGGGATGGAGCGGCAACGTTACGCGGTGTA
ATTGTTAGTGGACGGTCGTTACCGGCAGTCTTGATGACCCCGGCACGGATGGCGTTATCGGTTCCGCTCGTGAAC
ACTTTTACACATCCCCTTGTTGCGGGACCTGTGCTTGCTTCACACCCTTTCGATTTACAAGACTTTACAGAAGAA
GGGGTTAGCTCAGATAAAAAAGGTCATGTTGGGCCGCCCAGCGTTAACGTTGAGGCCAAGTTGACTGGAGTGGAT
GACGAAAAAGTAGAGAATGGAGGAGATCCGGCGGGGTTGTTGTTTGTGCGCGGGCCGCCAGTCGGCAAGATTGGA
AATGGTGATCAGAACGAAGATTACGTGCAGGTCTCGCCGACTGAGGAAAGACGGGTCAGAGACGAAAATGCAGAG
GAGGGCTGGATTAGCACTGGAGTTAGAGCGCAGGTACAACCTAATGGCTCGTTTATTGTCTTGTAA
Transcript >AgabiH39|061010
ATGTTCAATATATCCGACTACGTGGTCACCGACGACCTCACCATCCTCCTCGCCCTCATAGCGGCGACCACTTTT
CTCCTCAATAACCTCTACAAGCCTCAGCCACTGGTGCACCCCATATTGCTCGGCAGGCAGAGTGATGTCGGACGC
GCGCGTAATCCAGGAGAGAGTGCTGTCTATAGGAACTATGGAACTGGATTAATGGGCAGGTTTCCTGTGCGTCCC
AGCAAGGAGATTGCAATCCTACCACACCTTATTAAGCCGGAATCCGAGGCATCTCGTACCCTTTGGGCCACAAGG
GGAACCAACGCTGGCCTGCAAGATCGCATTGCCGCTCTGGGCAGCGGTCTCATCCGTCTTGCTGGTTTGAAGCCA
GGCGAGTCAAAGGTCCTTCTGCTCTTGAATGACGGAATCGAATTTATCATCGCCGATTTTGCACTTGCAACGCAT
TCCGTCATCTCCGTCACACTCAACTCTCAGGATCTATTGAAGCGGGTTTTGGAATCGCAGTCATTTTCTGCTATT
ATTGCCTCGCCAGAAATTGTTCCCCGCGTTCTTGAGACCATTTATGCCTCCAGTTTTAATTCCCGCCCTCATACT
ATCGTCATTGCTGGAGATGTCAGTCAACAGACTTTGGCTAGTGTCGCGAGCAACATCAAGATTCTCAAATTTAAC
GAGGTTGAACGGGAGGGAATCAAAGTTGACAAACTCGTTAGCAAACTTCCTGAACCCTCTGATATATATACTATG
ACCTACCTTTCCAATGAGGCTGGTCAGTTGCAGGTCGCGCAGTTGACTCATGAAAACGCGACTGCCGGGGTTGCT
GCCACCCGCAGTTTACTCCCAATTTCTCATGCCTTGTCACCTCTGGATACAATCATCTCGGCTTTTTCGCTTAGC
ACAGCTTACGGAAGAGTTATTGCATATACCGCCATTTATGAAGGAGCGAGTTTCGCGACGTTGCCTAGCTCGAAA
ATGTATCATGATGAACAGCCCGCAGCTCCTGCTGATGCTTCTGATATCTTAGCAGCCAAGAGATATCCCATTCCC
TCTCCGACGATCATGTTTATCCAACCTGGACATCTTATTGCCATTGTGACCGATATTTTGAAAAACGCCGCCGGA
TCAATGTTTTTGTTTCCGTTTGCAAGGAGGCACAAACTTGCAGGCATCAGCGACGGGTTTATCACAAGGGAGAGT
CTGTGGGATAGATTGGTCTTTGATGGAGCTCGCGCGAAAGTAATTGGGGATGGAGCGGCAACGTTACGCGGTGTA
ATTGTTAGTGGACGGTCGTTACCGGCAGTCTTGATGACCCCGGCACGGATGGCGTTATCGGTTCCGCTCGTGAAC
ACTTTTACACATCCCCTTGTTGCGGGACCTGTGCTTGCTTCACACCCTTTCGATTTACAAGACTTTACAGAAGAA
GGGGTTAGCTCAGATAAAAAAGGTCATGTTGGGCCGCCCAGCGTTAACGTTGAGGCCAAGTTGACTGGAGTGGAT
GACGAAAAAGTAGAGAATGGAGGAGATCCGGCGGGGTTGTTGTTTGTGCGCGGGCCGCCAGTCGGCAAGATTGGA
AATGGTGATCAGAACGAAGATTACGTGCAGGTCTCGCCGACTGAGGAAAGACGGGTCAGAGACGAAAATGCAGAG
GAGGGCTGGATTAGCACTGGAGTTAGAGCGCAGGTACAACCTAATGGCTCGTTTATTGTCTTGTAA
Gene >AgabiH39|061010
ATGTTCAATATATCCGACTACGTGGTCACCGACGACCTCACCATCCTCCTCGCCCTCATAGCGGCGACCACTTTT
CTCCTCAATAACCTCTACAAGCCTCAGCCACTGGTGCACCCCATATTGCTCGGCAGGCAGAGTGATGTCGGACGC
GCGCGTAATCCAGGAGAGAGTGCTGTCTATAGGAACTATGGAACTGGATTAATGGGCAGGGTATGTCTACACGTC
TTCTAATTCGCTCATCTTATGTACCCGATATATTAGTTTCCTGTGCGTCCCAGCAAGGAGATTGCAATCCTACCA
CACCTTATTAAGCCGGAATCCGAGGCATCTCGTACCCTTTGGGCCACAAGGGTGAGCTCTCCGTTGTCGTTTATG
CCACCCCTCATCTGACAGCTCTAGGGAACCAACGCTGGCCTGCAAGATCGCATTGCCGCTCTGGGCAGCGGTCTC
ATCCGTCTTGCTGGTTTGAAGCCAGGCGAGTCAAAGGTCCTTCTGCTCTTGAATGACGGAATCGGTGCGTTACAT
TCTTATTCTTCACTTCTGCTGGATTGACCGAGGAACACAGAATTTATCATCGCCGATTTTGCACTTGCAACGCAT
TCCGTCATCTCCGTCACACTCAACTCTCAGGATCTATTGAAGCGGGTTTTGGAATCGCAGTCATTTTCTGCTATT
ATTGCCTCGCCAGAAATTGTTCCCCGCGTTCTTGAGACCATTTATGCCTCCAGTTTTAATTCCCGCCCTCATACT
ATCGTCATTGCTGGAGATGTCAGTCAACAGACTTTGGCTAGTGTCGCGAGCAACATCAAGATTCTCAAATTTAAC
GAGGTTGAACGGGAGGGAATCAAAGTTGACAAACTCGTTAGCAAACTTCCTGGTATGTCTTCCGTCGTTTCTCTT
TATGTGACAAAGCTTATCTTGGTTGTAGAACCCTCTGATATATATACTATGACCTACCTTTCCAATGAGGCTGGT
CAGTTGCAGGTCGCGCAGTTGACTCATGAAAACGCGACTGCCGGGGTTGCTGCCACCCGCAGTTTACTCCCAATT
TCTCATGCCTTGTCACCTCTGGATACAATCATCTCGGCTTTTTCGCTTAGCACAGCTTACGGAAGAGTTATTGCA
TATACCGCCATTTATGAAGGAGCGAGTTTCGCGACGTTGCCTAGCTCGAAAATGTATCATGATGAACGTAAGTCA
CCATAATTTTCAACTCGATTTTCGTCTGACGTGCATTTGTGTACAGAGCCCGCAGCTCCTGCTGATGCTTCTGAT
ATCTTAGCAGCCAAGAGATATCCCATTCCCTCTCCGACGATCATGTTTATCCAACCTGGACATCTTATTGCCATT
GTGACCGATATTTTGAAAAACGCCGCCGGATCAATGTTTTTGTTTCCGTTTGCAAGGAGGCACAAACTTGCAGGC
ATCAGCGACGGGTTTATCACAAGGGAGAGTCTGTGGGATAGATTGGTCTTTGATGGAGCTCGCGCGAAAGTAATT
GGGGATGGAGCGGCAACGTTACGCGGTGTAATTGTTAGTGGACGTAAGTGCTAATGACAGATTCCATTCTATCTT
ACTGACAGTTCACACAGGGTCGTTACCGGCAGTCTTGATGACCCCGGCACGGATGGCGTTATCGGTTCCGCTCGT
GAACACTTTTACACATCCCCTTGTTGCGGGACCTGTGCTTGCTTCACACCCTTTCGATTTACAAGACTTTACAGA
AGAAGGGGTTAGCTCAGATAAAAAAGGTCATGTTGGGCCGCCCAGCGTTAACGTTGAGGCCAAGTTGACTGGAGT
GGATGACGAAAAAGTAGAGAATGGAGGAGATCCGGCGGGGTTGTTGTTTGTGCGCGGGCCGCCAGTCGGCAAGAT
TGGAAATGGTGATCAGAACGAAGATTACGTGCAGGTCTCGCCGACTGAGGAAAGACGGGTCAGAGACGAAAATGC
AGAGGAGGGCTGGATTAGCACTGGAGTTAGAGCGCAGGTACAACCTAATGGCTCGTTTATTGTCTTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail