Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|060860
Gene name
Locationscaffold_03:1888941..1890061
Strand+
Gene length (bp)1120
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01161 PBP Phosphatidylethanolamine-binding protein 3.9E-16 74 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31729|OV16_ONCVO OV-16 antigen OS=Onchocerca volvulus GN=OV16 PE=2 SV=2 30 201 1.0E-12
sp|P54185|OBA5_DROME Putative odorant-binding protein A5 OS=Drosophila melanogaster GN=a5 PE=2 SV=2 11 157 3.0E-12
sp|P54186|D1_ONCVO Protein D1 (Fragment) OS=Onchocerca volvulus GN=D1 PE=2 SV=1 49 201 3.0E-10
sp|P54187|D2_ONCVO Protein D2 (Fragment) OS=Onchocerca volvulus GN=D2 PE=2 SV=1 91 201 5.0E-10
sp|P54188|D3_ONCVO Protein D3 (Fragment) OS=Onchocerca volvulus GN=D3 PE=2 SV=1 65 201 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31729|OV16_ONCVO OV-16 antigen OS=Onchocerca volvulus GN=OV16 PE=2 SV=2 30 201 1.0E-12
sp|P54185|OBA5_DROME Putative odorant-binding protein A5 OS=Drosophila melanogaster GN=a5 PE=2 SV=2 11 157 3.0E-12
sp|P54186|D1_ONCVO Protein D1 (Fragment) OS=Onchocerca volvulus GN=D1 PE=2 SV=1 49 201 3.0E-10
sp|P54187|D2_ONCVO Protein D2 (Fragment) OS=Onchocerca volvulus GN=D2 PE=2 SV=1 91 201 5.0E-10
sp|P54188|D3_ONCVO Protein D3 (Fragment) OS=Onchocerca volvulus GN=D3 PE=2 SV=1 65 201 3.0E-08
sp|P14306|CPYI_YEAST Carboxypeptidase Y inhibitor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFS1 PE=1 SV=2 20 159 5.0E-08
sp|Q06252|YL179_YEAST Uncharacterized protein YLR179C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR179C PE=1 SV=1 28 205 5.0E-08
sp|P93003|TFL1_ARATH Protein TERMINAL FLOWER 1 OS=Arabidopsis thaliana GN=TFL1 PE=1 SV=1 24 157 8.0E-07
sp|Q96S96|PEBP4_HUMAN Phosphatidylethanolamine-binding protein 4 OS=Homo sapiens GN=PEBP4 PE=1 SV=3 90 157 7.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999741

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup2555
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|060860 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|060860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|060860
MHSYLAIVSTFLALAAAQQNSDTNMGLAAIEAHFNQSHIVPDLLSAFQPQAVLGVNFGAGDIQPGQKFTIEEAGS
APTLTVNSSSPLNGSYVLAMIDADVPNSQLQKHNRHWLVGNVTIGQDSVVSNATATSYSRYFGPFPPSGSGPHRY
VIMLYAQPSDFNPPAEFATTDLPVEPMDWQAYVNDSHLGGLVAANYIQVEQGTASASIFSTAPVVSSTLVAASTT
AGSATTSSTQTGSSNESNGAKVLDFHVPAVMCLATLATLLLA*
Coding >AgabiH39|060860
ATGCATTCTTACCTTGCCATCGTTTCAACGTTCCTGGCTCTCGCCGCCGCTCAACAAAATAGCGACACAAATATG
GGCCTCGCCGCTATTGAGGCTCACTTCAATCAGTCGCATATTGTCCCTGATTTGTTGTCTGCCTTCCAGCCTCAA
GCTGTCCTCGGAGTGAACTTTGGTGCGGGTGACATTCAGCCGGGCCAGAAGTTTACCATAGAAGAGGCTGGCTCT
GCACCCACTTTGACTGTCAACAGTTCCTCTCCCTTGAACGGGTCGTACGTGTTGGCCATGATAGACGCTGACGTG
CCCAACTCGCAATTACAAAAACACAACCGTCACTGGCTGGTTGGCAATGTCACAATTGGCCAAGACTCGGTGGTT
AGCAACGCGACAGCTACAAGCTACTCTCGCTACTTTGGCCCATTCCCGCCATCAGGTTCAGGTCCTCACCGTTAT
GTCATAATGTTATATGCACAACCTTCCGATTTCAACCCTCCTGCTGAGTTTGCAACGACCGACTTGCCTGTGGAA
CCAATGGACTGGCAAGCATATGTCAACGACTCGCACCTTGGAGGTCTTGTGGCTGCTAATTATATTCAGGTTGAA
CAAGGTACTGCTAGCGCATCAATCTTCTCCACTGCACCTGTCGTCTCTTCCACTTTGGTTGCTGCTTCGACTACT
GCTGGCTCTGCCACTACTTCTTCTACTCAAACTGGCTCGAGCAACGAGTCCAATGGAGCCAAGGTCCTGGATTTC
CACGTCCCAGCTGTCATGTGCTTAGCCACTCTTGCTACCTTACTTCTCGCATAA
Transcript >AgabiH39|060860
ATGCATTCTTACCTTGCCATCGTTTCAACGTTCCTGGCTCTCGCCGCCGCTCAACAAAATAGCGACACAAATATG
GGCCTCGCCGCTATTGAGGCTCACTTCAATCAGTCGCATATTGTCCCTGATTTGTTGTCTGCCTTCCAGCCTCAA
GCTGTCCTCGGAGTGAACTTTGGTGCGGGTGACATTCAGCCGGGCCAGAAGTTTACCATAGAAGAGGCTGGCTCT
GCACCCACTTTGACTGTCAACAGTTCCTCTCCCTTGAACGGGTCGTACGTGTTGGCCATGATAGACGCTGACGTG
CCCAACTCGCAATTACAAAAACACAACCGTCACTGGCTGGTTGGCAATGTCACAATTGGCCAAGACTCGGTGGTT
AGCAACGCGACAGCTACAAGCTACTCTCGCTACTTTGGCCCATTCCCGCCATCAGGTTCAGGTCCTCACCGTTAT
GTCATAATGTTATATGCACAACCTTCCGATTTCAACCCTCCTGCTGAGTTTGCAACGACCGACTTGCCTGTGGAA
CCAATGGACTGGCAAGCATATGTCAACGACTCGCACCTTGGAGGTCTTGTGGCTGCTAATTATATTCAGGTTGAA
CAAGGTACTGCTAGCGCATCAATCTTCTCCACTGCACCTGTCGTCTCTTCCACTTTGGTTGCTGCTTCGACTACT
GCTGGCTCTGCCACTACTTCTTCTACTCAAACTGGCTCGAGCAACGAGTCCAATGGAGCCAAGGTCCTGGATTTC
CACGTCCCAGCTGTCATGTGCTTAGCCACTCTTGCTACCTTACTTCTCGCATAA
Gene >AgabiH39|060860
ATGCATTCTTACCTTGCCATCGTTTCAACGTTCCTGGCTCTCGCCGCCGCTCAACAAAATAGCGACACAAATATG
GGCCTCGCCGCTATTGAGGCTCACTTCAATCAGTCGCATATTGTCCCTGATTTGTTGTCTGCCTTCCAGCCTCAA
GCTGTCCTCGGAGTGAACTTTGGTGAGTTTCAGTGGTTTGAAGTGGAAATGCCTAGCTCAAATCTTGTTAAAGGT
GCGGGTGACATTCAGCCGGGCCAGAAGTTTACCATAGAAGGTGTGTTTCCCTTTCGCCCATGTTCGTCGCAGCGT
GTTCACTGTGTTGCTCTGTAGAGGCTGGCTCTGCACCCACTTTGACTGTCAACAGTTCCTCTCCCTTGAACGGGT
CGTACGTGTTGGCCATGATAGACGCTGACGTGCCCAACTCGCAATTACAAAAACACAACCGTCACTGGCTGGTTG
GCAATGTCACAATTGGCCAAGGTCAGTCGAAAAGCAAATGCCCTACTCACTCAAGTTTTTGCTCACATATCACAG
ACTCGGTGGTTAGCAACGCGACAGCTACAAGCTACTCTCGCTACTTTGGCCCATTCCCGCCATCAGGTTCAGGTC
CTCACCGGTCAGCGTGGTTGCCAGCTTGGGGGTTCAGGAATGCTAACGGCTCACCAACAGTTATGTCATAATGTT
ATATGCACAACCTTCCGATTTCAACCCTCCTGCTGAGTTTGCAACGACCGACTTGCCTGTGGAACCAATGGACTG
GCAAGCATATGTCAACGTAAGGCCATCTTAACATCATGTATCTCCTGAATCTCATATTTTGTGCAGGACTCGCAC
CTTGGAGGTCTTGTGGCTGTAAGTAAGATATATCTCGAGTCTCGGCCACTTCACTGATTTTGCTCGACAGGCTAA
TTATATTCAGGTTGAACAAGGTACTGCTAGCGCATCAATCTTCTCCACTGCACCTGTCGTCTCTTCCACTTTGGT
TGCTGCTTCGACTACTGCTGGCTCTGCCACTACTTCTTCTACTCAAACTGGCTCGAGCAACGAGTCCAATGGAGC
CAAGGTCCTGGATTTCCACGTCCCAGCTGTCATGTGCTTAGCCACTCTTGCTACCTTACTTCTCGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail