Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|058770
Gene name
Locationscaffold_03:1486508..1489326
Strand-
Gene length (bp)2818
Transcript length (bp)2031
Coding sequence length (bp)2031
Protein length (aa) 677

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.5E-76 86 523

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LPS1|LACS6_ARATH Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana GN=LACS6 PE=1 SV=1 21 670 4.0E-145
sp|Q8LKS5|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 49 662 5.0E-140
sp|O88813|ACSL5_RAT Long-chain-fatty-acid--CoA ligase 5 OS=Rattus norvegicus GN=Acsl5 PE=1 SV=1 17 661 7.0E-135
sp|Q8JZR0|ACSL5_MOUSE Long-chain-fatty-acid--CoA ligase 5 OS=Mus musculus GN=Acsl5 PE=1 SV=1 17 661 6.0E-132
sp|Q9ULC5|ACSL5_HUMAN Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens GN=ACSL5 PE=1 SV=1 15 661 4.0E-130
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LPS1|LACS6_ARATH Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana GN=LACS6 PE=1 SV=1 21 670 4.0E-145
sp|Q8LKS5|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 49 662 5.0E-140
sp|O88813|ACSL5_RAT Long-chain-fatty-acid--CoA ligase 5 OS=Rattus norvegicus GN=Acsl5 PE=1 SV=1 17 661 7.0E-135
sp|Q8JZR0|ACSL5_MOUSE Long-chain-fatty-acid--CoA ligase 5 OS=Mus musculus GN=Acsl5 PE=1 SV=1 17 661 6.0E-132
sp|Q9ULC5|ACSL5_HUMAN Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens GN=ACSL5 PE=1 SV=1 15 661 4.0E-130
sp|Q9JID6|ACSL1_CAVPO Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1 54 662 9.0E-127
sp|P41216|ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 59 662 3.0E-126
sp|P18163|ACSL1_RAT Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus GN=Acsl1 PE=1 SV=1 59 662 5.0E-125
sp|P33121|ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens GN=ACSL1 PE=1 SV=1 31 662 3.0E-124
sp|Q9UKU0|ACSL6_HUMAN Long-chain-fatty-acid--CoA ligase 6 OS=Homo sapiens GN=ACSL6 PE=2 SV=4 4 663 5.0E-124
sp|Q55DR6|FCSA_DICDI Fatty acyl-CoA synthetase A OS=Dictyostelium discoideum GN=fcsA PE=1 SV=1 20 662 5.0E-121
sp|P33124|ACSL6_RAT Long-chain-fatty-acid--CoA ligase 6 OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 4 663 5.0E-121
sp|Q91WC3|ACSL6_MOUSE Long-chain-fatty-acid--CoA ligase 6 OS=Mus musculus GN=Acsl6 PE=1 SV=1 4 661 6.0E-121
sp|Q9C7W4|LACS3_ARATH Long chain acyl-CoA synthetase 3 OS=Arabidopsis thaliana GN=LACS3 PE=2 SV=1 49 661 1.0E-109
sp|Q9XIA9|LACS2_ARATH Long chain acyl-CoA synthetase 2 OS=Arabidopsis thaliana GN=LACS2 PE=2 SV=1 57 662 1.0E-108
sp|Q9T0A0|LACS4_ARATH Long chain acyl-CoA synthetase 4 OS=Arabidopsis thaliana GN=LACS4 PE=2 SV=1 29 661 2.0E-107
sp|Q9T009|LACS5_ARATH Long chain acyl-CoA synthetase 5 OS=Arabidopsis thaliana GN=LACS5 PE=2 SV=1 58 661 3.0E-106
sp|Q1ZXQ4|FCSB_DICDI Fatty acyl-CoA synthetase B OS=Dictyostelium discoideum GN=fcsB PE=2 SV=1 52 662 3.0E-104
sp|O22898|LACS1_ARATH Long chain acyl-CoA synthetase 1 OS=Arabidopsis thaliana GN=LACS1 PE=2 SV=1 29 661 7.0E-99
sp|P39518|LCF2_YEAST Long-chain-fatty-acid--CoA ligase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA2 PE=1 SV=1 68 664 2.0E-90
sp|O35547|ACSL4_RAT Long-chain-fatty-acid--CoA ligase 4 OS=Rattus norvegicus GN=Acsl4 PE=1 SV=1 54 662 6.0E-84
sp|Q9CZW4|ACSL3_MOUSE Long-chain-fatty-acid--CoA ligase 3 OS=Mus musculus GN=Acsl3 PE=1 SV=2 54 662 3.0E-83
sp|O60488|ACSL4_HUMAN Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens GN=ACSL4 PE=1 SV=2 54 662 3.0E-83
sp|Q9QUJ7|ACSL4_MOUSE Long-chain-fatty-acid--CoA ligase 4 OS=Mus musculus GN=Acsl4 PE=1 SV=2 54 662 1.0E-82
sp|Q9CAP8|LACS9_ARATH Long chain acyl-CoA synthetase 9, chloroplastic OS=Arabidopsis thaliana GN=LACS9 PE=1 SV=1 51 662 1.0E-82
sp|Q63151|ACSL3_RAT Long-chain-fatty-acid--CoA ligase 3 OS=Rattus norvegicus GN=Acsl3 PE=1 SV=1 54 662 3.0E-82
sp|O95573|ACSL3_HUMAN Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens GN=ACSL3 PE=1 SV=3 54 662 2.0E-79
sp|Q5R668|ACSL3_PONAB Long-chain-fatty-acid--CoA ligase 3 OS=Pongo abelii GN=ACSL3 PE=2 SV=2 54 662 3.0E-78
sp|Q9SJD4|LACS8_ARATH Long chain acyl-CoA synthetase 8 OS=Arabidopsis thaliana GN=LACS8 PE=1 SV=1 54 662 1.0E-76
sp|P30624|LCF1_YEAST Long-chain-fatty-acid--CoA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA1 PE=1 SV=1 127 662 3.0E-65
sp|Q9P7D7|LCF2_SCHPO Long-chain-fatty-acid--CoA ligase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf2 PE=3 SV=1 18 662 4.0E-64
sp|B2HGV4|FAC15_MYCMM Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD15 PE=3 SV=1 94 661 2.0E-61
sp|Q7TYX8|FAC15_MYCBO Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD15 PE=3 SV=2 94 661 1.0E-58
sp|O53521|FAC15_MYCTU Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD15 PE=1 SV=3 94 661 4.0E-58
sp|O60135|LCF1_SCHPO Long-chain-fatty-acid--CoA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf1 PE=3 SV=1 32 662 1.0E-55
sp|P39002|LCF3_YEAST Long-chain-fatty-acid--CoA ligase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA3 PE=1 SV=1 120 661 1.0E-54
sp|P47912|LCF4_YEAST Long-chain-fatty-acid--CoA ligase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA4 PE=1 SV=1 127 661 2.0E-54
sp|P44446|LCFH_HAEIN Putative long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0002 PE=3 SV=1 79 661 5.0E-50
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 134 661 6.0E-45
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 83 661 5.0E-43
sp|P16405|ORA_PLAFN Octapeptide-repeat antigen (Fragment) OS=Plasmodium falciparum (isolate NF7 / Ghana) PE=2 SV=1 243 646 5.0E-38
sp|Q9V3S9|BGM_DROME Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster GN=bgm PE=2 SV=1 89 662 7.0E-37
sp|Q7ZYC4|ACBG2_XENLA Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopus laevis GN=acsbg2 PE=2 SV=1 116 671 7.0E-35
sp|Q5ZKR7|ACBG2_CHICK Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus GN=ACSBG2 PE=2 SV=2 125 672 9.0E-33
sp|P9WQ53|FAD11_MYCTU Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD11 PE=3 SV=1 243 662 4.0E-32
sp|P9WQ52|FAD11_MYCTO Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD11 PE=3 SV=1 243 662 4.0E-32
sp|Q5FVE4|ACBG2_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Homo sapiens GN=ACSBG2 PE=1 SV=2 125 661 1.0E-31
sp|Q4R4P9|ACBG1_MACFA Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Macaca fascicularis GN=ACSBG1 PE=2 SV=2 124 661 2.0E-30
sp|Q2XU92|ACBG2_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus GN=Acsbg2 PE=1 SV=1 116 661 3.0E-30
sp|A1L1K7|ACBG2_RAT Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Rattus norvegicus GN=Acsbg2 PE=2 SV=1 125 662 4.0E-30
sp|Q96GR2|ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens GN=ACSBG1 PE=2 SV=2 116 661 9.0E-30
sp|Q2KHW5|ACBG1_BOVIN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Bos taurus GN=ACSBG1 PE=2 SV=1 93 661 4.0E-29
sp|Q99PU5|ACBG1_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Mus musculus GN=Acsbg1 PE=1 SV=1 124 661 8.0E-28
sp|Q9LK39|AAE16_ARATH Probable acyl-activating enzyme 16, chloroplastic OS=Arabidopsis thaliana GN=AAE16 PE=2 SV=1 243 661 2.0E-27
sp|Q924N5|ACBG1_RAT Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus GN=Acsbg1 PE=1 SV=1 124 661 2.0E-27
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 239 549 3.0E-27
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 49 549 2.0E-26
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 196 549 5.0E-25
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 244 549 5.0E-24
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 196 563 1.0E-23
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 242 549 5.0E-23
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 243 555 1.0E-22
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 196 544 1.0E-22
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 49 549 3.0E-22
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 243 549 1.0E-21
sp|Q9V3U0|BGML_DROME Long-chain-fatty-acid--CoA ligase bubblegum-like OS=Drosophila melanogaster GN=CG4500 PE=2 SV=1 87 562 5.0E-21
sp|Q8W471|AAE15_ARATH Long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15, chloroplastic OS=Arabidopsis thaliana GN=AAE15 PE=1 SV=1 244 662 6.0E-21
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 196 549 8.0E-21
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 90 549 8.0E-21
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 45 538 1.0E-20
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 121 553 1.0E-20
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 243 549 1.0E-20
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 84 551 1.0E-20
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 236 549 2.0E-20
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 107 542 4.0E-20
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 244 549 7.0E-20
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 244 549 7.0E-20
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 84 551 1.0E-19
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 84 551 1.0E-19
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 216 585 3.0E-19
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 123 551 5.0E-19
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 84 582 9.0E-19
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 84 582 9.0E-19
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 115 551 1.0E-18
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 165 568 2.0E-18
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 116 551 5.0E-18
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 98 551 7.0E-18
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 246 551 8.0E-18
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 163 568 9.0E-18
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 244 542 9.0E-18
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 121 553 1.0E-17
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 165 551 1.0E-17
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 83 551 1.0E-17
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 33 551 2.0E-17
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 171 568 2.0E-17
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 242 551 3.0E-17
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 117 562 4.0E-17
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 244 551 4.0E-17
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 171 568 5.0E-17
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 121 553 8.0E-17
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 110 551 9.0E-17
sp|Q9LQ12|4CLL1_ARATH 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 246 549 1.0E-16
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 240 602 6.0E-16
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 110 551 2.0E-15
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 123 551 3.0E-15
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 93 549 1.0E-14
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 92 534 1.0E-14
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 235 544 5.0E-14
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 163 551 6.0E-14
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 156 564 6.0E-14
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 93 549 6.0E-14
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 83 551 1.0E-13
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 123 563 2.0E-13
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 117 551 3.0E-13
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 92 551 3.0E-13
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 401 570 3.0E-13
sp|Q00594|ALKK_PSEOL Medium-chain-fatty-acid--CoA ligase OS=Pseudomonas oleovorans GN=alkK PE=3 SV=1 93 549 8.0E-13
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 213 537 9.0E-13
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 117 542 1.0E-12
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 242 563 1.0E-12
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 234 544 2.0E-12
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 165 549 3.0E-12
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 248 596 4.0E-12
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 248 596 4.0E-12
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 231 575 4.0E-12
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 248 596 4.0E-12
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 248 596 4.0E-12
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 248 596 5.0E-12
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 248 596 6.0E-12
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 248 596 9.0E-12
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 399 549 9.0E-12
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 165 544 1.0E-11
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 400 549 1.0E-11
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 116 544 2.0E-11
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 248 596 2.0E-11
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 194 585 3.0E-11
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 248 596 3.0E-11
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 437 551 3.0E-11
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 248 596 3.0E-11
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 437 551 4.0E-11
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 248 596 5.0E-11
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 248 596 6.0E-11
sp|P31686|4CL1_SOYBN 4-coumarate--CoA ligase 1 (Fragment) OS=Glycine max PE=2 SV=1 401 549 7.0E-11
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 233 537 2.0E-10
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 233 537 4.0E-10
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 233 537 5.0E-10
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 233 537 5.0E-10
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 233 537 5.0E-10
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 233 537 6.0E-10
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 233 537 6.0E-10
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 233 537 6.0E-10
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 233 537 6.0E-10
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 233 537 6.0E-10
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 233 537 6.0E-10
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 233 537 6.0E-10
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 233 537 6.0E-10
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 249 565 6.0E-10
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 249 565 6.0E-10
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 233 537 6.0E-10
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 233 537 6.0E-10
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 233 537 9.0E-10
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 233 537 9.0E-10
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 239 537 9.0E-10
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 233 537 1.0E-09
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 233 537 1.0E-09
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 433 583 1.0E-09
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 243 537 1.0E-09
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 236 551 1.0E-09
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 460 551 2.0E-09
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 460 551 2.0E-09
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 460 551 2.0E-09
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 460 551 2.0E-09
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 460 551 2.0E-09
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 460 551 2.0E-09
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 460 551 2.0E-09
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 460 551 2.0E-09
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 460 551 2.0E-09
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 460 551 2.0E-09
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 460 551 2.0E-09
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 194 583 3.0E-09
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 243 537 3.0E-09
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 461 563 3.0E-09
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 460 551 4.0E-09
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 460 551 4.0E-09
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 248 549 5.0E-09
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 467 563 6.0E-09
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 467 563 6.0E-09
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 467 563 6.0E-09
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 467 563 6.0E-09
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 467 563 6.0E-09
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 467 563 6.0E-09
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 461 563 9.0E-09
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 461 563 9.0E-09
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 461 563 9.0E-09
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 461 563 9.0E-09
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 461 563 9.0E-09
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 467 563 1.0E-08
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 467 563 1.0E-08
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 467 563 1.0E-08
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 467 563 1.0E-08
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 467 563 1.0E-08
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 467 563 1.0E-08
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 467 563 2.0E-08
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 467 563 2.0E-08
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 467 563 2.0E-08
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 467 563 2.0E-08
sp|Q5HNB2|MENE_STAEQ 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 218 537 2.0E-08
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 219 544 4.0E-08
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 401 544 4.0E-08
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 436 596 7.0E-08
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 467 563 1.0E-07
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 467 563 1.0E-07
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 467 563 1.0E-07
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 436 584 1.0E-07
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 243 536 1.0E-07
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 400 557 1.0E-07
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 93 312 1.0E-07
sp|Q7F1X5|4CLL5_ORYSJ 4-coumarate--CoA ligase-like 5 OS=Oryza sativa subsp. japonica GN=4CLL5 PE=2 SV=1 247 549 1.0E-07
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 384 544 2.0E-07
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 442 549 2.0E-07
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 244 584 2.0E-07
sp|Q9SS01|AAE20_ARATH Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 399 549 2.0E-07
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 394 522 3.0E-07
sp|Q8CS21|MENE_STAES 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menE PE=3 SV=1 218 537 3.0E-07
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 442 549 4.0E-07
sp|P37418|MENE_SALTY 2-succinylbenzoate--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=menE PE=3 SV=2 423 549 4.0E-07
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 460 585 5.0E-07
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 467 549 8.0E-07
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 403 551 1.0E-06
sp|Q9C9G2|AEE22_ARATH Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 467 549 1.0E-06
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 218 297 2.0E-06
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 218 297 2.0E-06
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 218 297 2.0E-06
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 218 297 2.0E-06
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 218 297 2.0E-06
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 218 297 2.0E-06
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 464 557 2.0E-06
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 463 551 2.0E-06
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 244 551 2.0E-06
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 244 551 2.0E-06
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 244 551 2.0E-06
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 244 551 2.0E-06
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 244 551 2.0E-06
sp|Q53634|MENE_STAAU 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus GN=menE PE=3 SV=1 244 551 2.0E-06
sp|A8Z4L9|MENE_STAAT 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menE PE=3 SV=1 244 551 2.0E-06
sp|A6QHX6|MENE_STAAE 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Newman) GN=menE PE=3 SV=1 244 551 2.0E-06
sp|Q5HEY2|MENE_STAAC 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain COL) GN=menE PE=3 SV=1 244 551 2.0E-06
sp|Q2G2V3|MENE_STAA8 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=menE PE=3 SV=1 244 551 2.0E-06
sp|Q2FFU9|MENE_STAA3 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300) GN=menE PE=3 SV=1 244 551 2.0E-06
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 436 551 2.0E-06
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 244 544 2.0E-06
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 218 297 3.0E-06
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 218 297 3.0E-06
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 224 297 3.0E-06
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 224 297 3.0E-06
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 218 297 3.0E-06
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 244 551 3.0E-06
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 244 551 3.0E-06
sp|P37353|MENE_ECOLI 2-succinylbenzoate--CoA ligase OS=Escherichia coli (strain K12) GN=menE PE=1 SV=2 243 549 4.0E-06
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 244 583 4.0E-06
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 243 544 4.0E-06
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 401 544 5.0E-06
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 432 551 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1286
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|058770 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|103800
Agaricus bisporus var bisporus H97 AgabiH97|058770
Agaricus bisporus var bisporus H97 AgabiH97|103800
Rhodonia placenta FPRL280 RhoplFPRL280|12_41

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|058770
MPLNREKVVDWPDNLPFDRQSIPVPGTKRPGQTAHYRNALWGFIDENTPNHFVTLDQIFEGGLKTGREREFLGYR
PILSMNPLKFADQYEWLTWGDVDNKRRYIGSALHSLFSKGEVGGGEHETVGIWSANRPEWQILDIAMQNYKKVSV
SLYDTLGKDAVEYIINHAHTTVVFATSEHASTLLKLAPKVPCLKLVIIIDSVSVQSAKLFAEWGQSVDIRVLEWH
ELEAYGKANLIEPIKPAPDTIASICYTSGTTDKPKGVILTHKSLAMAVSSNLYGLTLPDDGILMSYLPLAHIYER
LCELCAVAVGGRIGYFSGDPLRLLEDAQILKPNLFPSVPRVLNRIYQAAMAGGNVPGLKGKIFRKALDTKLERLH
VTGEVTHPLWDRIVFRKIQRVLGGQLQLVTSGSAPISAEIMDFIKIAFACEVSEGDPSASGTVGPPVPVNEVKLV
DVPSLGYTTEDKPNPRGELCIRGANVFVEYYKDAKNTKETIDEEGWLRTGDVAEIDSVGRVKIIDRVKNIMKLAQ
GEYVALEKIENLFSAYPSLAQIYVYGDSLQSYLVAIIVPDPVALASIASEMLGKHITPEDQAGLEEAIKDAHVNA
HFLSGLTAYGQKLGLRGFEMIKRIHLSLVPFSIENDTLTPTMKIKRREATKLYESEIAALYALGEPTSNRTSKSL
L*
Coding >AgabiH39|058770
ATGCCTCTGAACAGAGAAAAAGTCGTCGACTGGCCCGACAATCTTCCCTTCGATAGACAGTCAATTCCTGTTCCT
GGAACAAAGCGCCCTGGACAAACTGCTCACTATCGCAATGCTCTTTGGGGCTTTATCGACGAGAATACTCCTAAC
CATTTCGTGACCCTGGATCAAATTTTTGAGGGTGGACTAAAGACGGGTAGAGAACGCGAGTTCCTAGGTTATCGT
CCCATCCTTTCGATGAACCCTCTCAAATTCGCGGATCAATATGAGTGGCTGACATGGGGTGACGTTGATAACAAA
AGAAGATATATCGGCAGTGCTCTACATAGTCTCTTCAGCAAGGGTGAGGTTGGAGGAGGAGAACATGAAACCGTT
GGTATATGGTCTGCGAATCGTCCAGAGTGGCAAATCCTCGATATTGCAATGCAGAATTACAAGAAGGTTTCCGTG
AGCTTGTATGACACATTGGGCAAGGATGCTGTTGAATACATTATCAATCATGCGCACACCACCGTGGTGTTTGCG
ACCTCGGAACATGCATCCACCCTCCTCAAGCTCGCCCCTAAAGTCCCTTGTTTGAAGCTAGTGATTATCATTGAC
AGCGTTTCTGTTCAATCCGCCAAACTCTTTGCTGAGTGGGGTCAATCCGTTGACATCAGAGTACTGGAATGGCAT
GAACTTGAAGCCTACGGGAAAGCTAATCTTATTGAGCCTATCAAACCCGCACCCGATACGATTGCGTCCATTTGT
TACACTTCTGGAACCACCGATAAGCCTAAAGGCGTGATTCTCACACATAAGTCACTTGCCATGGCCGTCAGTTCC
AATTTGTACGGCCTGACCTTACCCGACGATGGCATTCTCATGTCATATTTACCTTTGGCTCATATCTATGAGCGA
TTATGCGAGCTCTGTGCGGTAGCTGTTGGTGGTCGAATCGGGTATTTCTCGGGCGATCCTCTCCGCCTACTCGAA
GATGCGCAAATCCTGAAGCCAAACCTTTTCCCTTCAGTTCCCCGCGTCCTGAACCGCATATATCAAGCAGCCATG
GCCGGTGGTAATGTTCCTGGTTTGAAAGGGAAAATCTTCAGGAAAGCCTTGGATACTAAGTTGGAAAGACTCCAC
GTCACGGGCGAGGTTACACATCCCCTTTGGGATAGGATCGTTTTCCGAAAAATCCAAAGAGTCCTTGGTGGACAA
CTTCAACTCGTCACAAGTGGTTCAGCACCTATCAGTGCGGAGATCATGGACTTCATCAAAATCGCGTTCGCATGT
GAGGTTAGCGAAGGCGATCCCAGTGCTAGTGGTACCGTTGGGCCTCCTGTGCCGGTCAACGAGGTCAAACTGGTG
GATGTTCCATCTTTGGGCTATACAACCGAGGACAAGCCAAATCCTCGTGGCGAGCTTTGTATTCGTGGCGCTAAC
GTATTTGTCGAATATTACAAGGATGCAAAGAACACCAAAGAAACCATCGACGAGGAAGGTTGGCTGCGCACTGGT
GATGTCGCCGAAATCGATTCTGTTGGTCGTGTAAAGATCATCGACCGAGTCAAGAACATAATGAAACTTGCGCAG
GGCGAATATGTCGCCCTAGAGAAGATTGAGAACTTGTTTAGCGCTTACCCTTCCCTTGCTCAAATCTACGTCTAC
GGCGACTCGCTTCAGTCATACTTGGTTGCAATCATCGTTCCCGATCCTGTTGCTCTCGCCAGTATTGCATCGGAA
ATGTTGGGAAAACATATCACCCCAGAGGATCAGGCAGGACTGGAGGAGGCAATCAAAGACGCTCATGTGAACGCA
CATTTTTTGAGTGGGTTGACGGCCTATGGTCAGAAACTTGGTCTTAGAGGATTCGAGATGATCAAGCGAATCCAT
TTGTCTCTTGTCCCTTTCTCCATTGAGAACGACACTCTCACTCCCACTATGAAGATCAAGCGACGAGAGGCCACA
AAGCTCTACGAAAGCGAAATCGCTGCCCTCTATGCCTTGGGCGAACCTACTTCGAATAGGACATCGAAGTCTCTT
CTTTAA
Transcript >AgabiH39|058770
ATGCCTCTGAACAGAGAAAAAGTCGTCGACTGGCCCGACAATCTTCCCTTCGATAGACAGTCAATTCCTGTTCCT
GGAACAAAGCGCCCTGGACAAACTGCTCACTATCGCAATGCTCTTTGGGGCTTTATCGACGAGAATACTCCTAAC
CATTTCGTGACCCTGGATCAAATTTTTGAGGGTGGACTAAAGACGGGTAGAGAACGCGAGTTCCTAGGTTATCGT
CCCATCCTTTCGATGAACCCTCTCAAATTCGCGGATCAATATGAGTGGCTGACATGGGGTGACGTTGATAACAAA
AGAAGATATATCGGCAGTGCTCTACATAGTCTCTTCAGCAAGGGTGAGGTTGGAGGAGGAGAACATGAAACCGTT
GGTATATGGTCTGCGAATCGTCCAGAGTGGCAAATCCTCGATATTGCAATGCAGAATTACAAGAAGGTTTCCGTG
AGCTTGTATGACACATTGGGCAAGGATGCTGTTGAATACATTATCAATCATGCGCACACCACCGTGGTGTTTGCG
ACCTCGGAACATGCATCCACCCTCCTCAAGCTCGCCCCTAAAGTCCCTTGTTTGAAGCTAGTGATTATCATTGAC
AGCGTTTCTGTTCAATCCGCCAAACTCTTTGCTGAGTGGGGTCAATCCGTTGACATCAGAGTACTGGAATGGCAT
GAACTTGAAGCCTACGGGAAAGCTAATCTTATTGAGCCTATCAAACCCGCACCCGATACGATTGCGTCCATTTGT
TACACTTCTGGAACCACCGATAAGCCTAAAGGCGTGATTCTCACACATAAGTCACTTGCCATGGCCGTCAGTTCC
AATTTGTACGGCCTGACCTTACCCGACGATGGCATTCTCATGTCATATTTACCTTTGGCTCATATCTATGAGCGA
TTATGCGAGCTCTGTGCGGTAGCTGTTGGTGGTCGAATCGGGTATTTCTCGGGCGATCCTCTCCGCCTACTCGAA
GATGCGCAAATCCTGAAGCCAAACCTTTTCCCTTCAGTTCCCCGCGTCCTGAACCGCATATATCAAGCAGCCATG
GCCGGTGGTAATGTTCCTGGTTTGAAAGGGAAAATCTTCAGGAAAGCCTTGGATACTAAGTTGGAAAGACTCCAC
GTCACGGGCGAGGTTACACATCCCCTTTGGGATAGGATCGTTTTCCGAAAAATCCAAAGAGTCCTTGGTGGACAA
CTTCAACTCGTCACAAGTGGTTCAGCACCTATCAGTGCGGAGATCATGGACTTCATCAAAATCGCGTTCGCATGT
GAGGTTAGCGAAGGCGATCCCAGTGCTAGTGGTACCGTTGGGCCTCCTGTGCCGGTCAACGAGGTCAAACTGGTG
GATGTTCCATCTTTGGGCTATACAACCGAGGACAAGCCAAATCCTCGTGGCGAGCTTTGTATTCGTGGCGCTAAC
GTATTTGTCGAATATTACAAGGATGCAAAGAACACCAAAGAAACCATCGACGAGGAAGGTTGGCTGCGCACTGGT
GATGTCGCCGAAATCGATTCTGTTGGTCGTGTAAAGATCATCGACCGAGTCAAGAACATAATGAAACTTGCGCAG
GGCGAATATGTCGCCCTAGAGAAGATTGAGAACTTGTTTAGCGCTTACCCTTCCCTTGCTCAAATCTACGTCTAC
GGCGACTCGCTTCAGTCATACTTGGTTGCAATCATCGTTCCCGATCCTGTTGCTCTCGCCAGTATTGCATCGGAA
ATGTTGGGAAAACATATCACCCCAGAGGATCAGGCAGGACTGGAGGAGGCAATCAAAGACGCTCATGTGAACGCA
CATTTTTTGAGTGGGTTGACGGCCTATGGTCAGAAACTTGGTCTTAGAGGATTCGAGATGATCAAGCGAATCCAT
TTGTCTCTTGTCCCTTTCTCCATTGAGAACGACACTCTCACTCCCACTATGAAGATCAAGCGACGAGAGGCCACA
AAGCTCTACGAAAGCGAAATCGCTGCCCTCTATGCCTTGGGCGAACCTACTTCGAATAGGACATCGAAGTCTCTT
CTTTAA
Gene >AgabiH39|058770
ATGCCTCTGAACAGAGAAAAAGTCGTCGACTGGCCCGACAATCTTCCCTTCGATAGACAGTCAATTCCTGTTCCT
GGAACAAAGCGCCCTGGACAAACTGGTTTGTGAATGTCCATCTTGACTTGACCACCCCAGCTAACTTTTATACAC
CAGCTCACTATCGCAATGGTACATATTGCGAACGATCTTTCTTCACGTAGCATGCTTATGTCTCCACTCAGCTCT
TTGGGGCTTTATCGACGAGAATACTCCTAACCATTTCGTGACCCTGGATCAAATTTTTGAGGGTGGACTAAAGAC
GGGTAGAGAACGCGAGTTCCTAGGTTATCGTCCCATCCTTTCGATGAACCCTCTCAAATTCGCGGATCAATATGA
GTGGCTGACATGGGGTGACGTTGATAACAAAAGAAGATATATCGGCAGTGCTCTACATAGTCTCTTCAGCAAGGG
TGAGGTTGGAGGAGGAGAACATGAAACCGTTGGTATATGGTCTGCGAATCGTCCAGGTGTGTCTCATATAGATAC
ACATACTTATAGTCGTCTGACTAGCGCAGAGTGGCAAATCCTCGATATTGCAATGCAGAATTACAAGAAGGTTTC
CGTGAGCTTGTATGACACATTGGGCAAGGATGCTGTTGGTAAGATTCGGACTTTCGACTTCTCAGCTCTTAGTAA
CACTATTCGACGCCCACTCCTTCAGAATACATGTAATGTGACTCTCTCAACTCTGGAATTGGCCCTCCTCACACC
TGGTTTTCTAGTATCAATCATGCGCACACCACCGTGGTGTTTGCGACCTCGGAACATGCATCCACCCTCCTCAAG
CTCGCCCCTAAAGTCCCTTGTTTGAAGCTAGTGATTATCATTGACAGCGTTTCTGTTCAATCCGCCAAACTCTTT
GCTGAGTGGGGTCAATCCGTTGACATCAGAGTACTGGAATGGCATGAACGTACGTTCATTATCAAAAAGCAGTAT
TCACGAATTTCATTTTCTTTCCAGTTGAAGCCTACGGGAAAGCTAATCTTATTGAGCCTATCAAACCCGCACCCG
ATACGATTGCGTCCATTTGTTACACTTCTGTGAGGGACAACTCTCTCCCTTCTAGGCTCACTACTAATCCAAATC
GTCCTCCTGCTAGGGAACCACCGATAAGCCTAAAGGTAAACCGTCTTGTCGGATCACATAGGATGTCTGATTTAA
GAATAATGCCTGTTAGGCGTGATTCTCACACATAAGTCACTTGCCATGGCCGTCAGTTCCAATTTGTACGGCCTG
ACCTTACCCGACGATGGCATTCTCATGTCATATTTACCTTTGGCTCATATCTATGAGGTGAAATGGTTCTTCTTA
CTGTCTTTAATTGAATCTGACTTCGTCCCAGCGATTATGCGAGCTCTGTGCGGTAGCTGTTGGTGGTCGAATCGG
GTATTTCTCGGGCGATCCTCTCCGCCTACTCGAAGATGCGCAAATCCTGAAGCCAAACCTTTTCCCTTCAGTTCC
CCGCGTCCTGAACCGCATATATCAAGCAGCCATGGCCGGTGGTAATGTTCCTGGTTTGAAAGGGAAAATCTTCAG
GAAAGCCTTGGATACTAAGTTGGAAAGACTCCACGTCACGGGCGAGGTTACACATCCCCTTTGGGATAGGATCGT
TTTCCGAAAAGTGAGAGGCTAATCTGTCATTCTAATTTGGTAATTTGTGAACTGTTCCTCAGATCCAAAGAGTCC
TTGGTGGACAACTTCAACTCGTCACAAGTGGTTCAGCACCTATCAGTGCGGAGATCATGGACTTCATCAAAATCG
CGTTCGCATGTGAGGTTAGCGAAGGTATGTCGTTCTGAGATAATTGACTTCATAAACTAACATTCGTTTGAAGGG
TACGAAATTTTCAATTTTATTGATTGCATCTAACAGTTGTTCTTATGTAGATATGGCATGACAGAATCTATGGCG
ACATGCACAAGATCTTGGCCAGGCGATCCCAGTGCTAGTGGTACCGTTGGGCCTCCTGTGCCGGTCAACGAGGTC
AAACTGGTGGATGTTCCATCTTTGGGCTATACAACCGAGGACAAGCCAAATCCTCGTGGCGAGCTTTGTATTCGT
GGCGCTAACGTATTTGTCGAATATTACAAGGGCAAGTCGATCAGGCGCCTTTGACTATCTCCGCTCACCTGCCAT
ATAGATGCAAAGAACACCAAAGAAACCATCGACGAGGAAGGTTGGCTGCGCACTGGTGATGTCGCCGAAATCGAT
TCTGTTGGTCGTGTAAAGATCATCGACCGAGTCAAGAACATAATGAAACTTGCGCAGGGCGAATATGTCGCCCTA
GAGAAGATTGAGAACTTGTTTAGCGCTTACCCTTCCCTTGCTCAAATCTACGTCTACGGCGACTCGCTTCAGTCA
TACTTGGTTGCAATCATCGTTCCCGATCCTGTTGCTCTCGCCAGTATTGCATCGGAAATGTTGGGAAAACATATC
ACCCCAGAGGATCAGGCAGGACTGGAGGAGGCAATCAAAGACGCTCATGTGAACGCACATTTTTTGAGTGGGTTG
ACGGCCTATGGTCAGAAACTTGGTCTTAGAGGGTAAATATTTTCTTTGCAACGTTGCATGTTTGATGATTGATTT
CACGTATCATAGATTCGAGATGATCAAGCGAATCCATTTGTCTCTTGTCCCTTTCTCCATTGAGAACGACACTCT
CACTCCCACTATGAAGATCAAGCGACGAGAGGCCACAAAGCTCTACGAAAGCGAAATCGCTGCCCTCTATGCCTT
GGGCGAACCTACTTCGAATAGGACATCGAAGTCTCTTCTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail