Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|057780
Gene name
Locationscaffold_03:1258222..1260837
Strand+
Gene length (bp)2615
Transcript length (bp)2145
Coding sequence length (bp)2145
Protein length (aa) 715

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01602 Adaptin_N Adaptin N terminal region 1.1E-122 29 536
PF12717 Cnd1 non-SMC mitotic condensation complex subunit 1 2.2E-53 107 270
PF13646 HEAT_2 HEAT repeats 4.4E-07 94 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P63009|AP2B1_BOVIN AP-2 complex subunit beta OS=Bos taurus GN=AP2B1 PE=1 SV=2 7 593 0.0E+00
sp|Q54X82|AP1B_DICDI AP-1 complex subunit beta OS=Dictyostelium discoideum GN=ap1b1 PE=3 SV=1 7 593 0.0E+00
sp|P52303|AP1B1_RAT AP-1 complex subunit beta-1 OS=Rattus norvegicus GN=Ap1b1 PE=1 SV=1 7 627 0.0E+00
sp|Q9SUS3|APBLB_ARATH Beta-adaptin-like protein B OS=Arabidopsis thaliana GN=BETAB-AD PE=1 SV=1 5 588 0.0E+00
sp|Q10567|AP1B1_HUMAN AP-1 complex subunit beta-1 OS=Homo sapiens GN=AP1B1 PE=1 SV=2 7 608 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P63009|AP2B1_BOVIN AP-2 complex subunit beta OS=Bos taurus GN=AP2B1 PE=1 SV=2 7 593 0.0E+00
sp|Q54X82|AP1B_DICDI AP-1 complex subunit beta OS=Dictyostelium discoideum GN=ap1b1 PE=3 SV=1 7 593 0.0E+00
sp|P52303|AP1B1_RAT AP-1 complex subunit beta-1 OS=Rattus norvegicus GN=Ap1b1 PE=1 SV=1 7 627 0.0E+00
sp|Q9SUS3|APBLB_ARATH Beta-adaptin-like protein B OS=Arabidopsis thaliana GN=BETAB-AD PE=1 SV=1 5 588 0.0E+00
sp|Q10567|AP1B1_HUMAN AP-1 complex subunit beta-1 OS=Homo sapiens GN=AP1B1 PE=1 SV=2 7 608 0.0E+00
sp|O35643|AP1B1_MOUSE AP-1 complex subunit beta-1 OS=Mus musculus GN=Ap1b1 PE=1 SV=2 7 608 0.0E+00
sp|P63010|AP2B1_HUMAN AP-2 complex subunit beta OS=Homo sapiens GN=AP2B1 PE=1 SV=1 7 593 0.0E+00
sp|Q9DBG3|AP2B1_MOUSE AP-2 complex subunit beta OS=Mus musculus GN=Ap2b1 PE=1 SV=1 7 593 0.0E+00
sp|P62944|AP2B1_RAT AP-2 complex subunit beta OS=Rattus norvegicus GN=Ap2b1 PE=1 SV=1 7 593 0.0E+00
sp|Q08DS7|AP1B1_BOVIN AP-1 complex subunit beta-1 OS=Bos taurus GN=AP2B1 PE=2 SV=1 7 593 0.0E+00
sp|O81742|APBLC_ARATH Beta-adaptin-like protein C OS=Arabidopsis thaliana GN=BETAC-AD PE=1 SV=2 5 588 0.0E+00
sp|O43005|AP2B_SCHPO AP-2 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl1 PE=3 SV=1 23 607 6.0E-163
sp|O43079|AP1B1_SCHPO AP-1 complex subunit beta-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl2 PE=1 SV=1 6 588 2.0E-139
sp|P36000|AP1B1_YEAST AP-1 complex subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL2 PE=1 SV=1 9 582 9.0E-104
sp|P27351|AP2B_YEAST AP-2 complex subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL1 PE=1 SV=2 7 663 4.0E-95
sp|Q9LDK9|APBLA_ARATH Beta-adaptin-like protein A OS=Arabidopsis thaliana GN=BETAA-AD PE=1 SV=1 13 587 5.0E-86
sp|Q9WV76|AP4B1_MOUSE AP-4 complex subunit beta-1 OS=Mus musculus GN=Ap4b1 PE=1 SV=2 34 551 3.0E-67
sp|Q9Y6B7|AP4B1_HUMAN AP-4 complex subunit beta-1 OS=Homo sapiens GN=AP4B1 PE=1 SV=2 34 539 1.0E-63
sp|Q54R84|AP4B_DICDI AP-4 complex subunit beta OS=Dictyostelium discoideum GN=ap4b1 PE=3 SV=1 5 590 1.0E-60
sp|Q7YRF1|AP3B1_CANLF AP-3 complex subunit beta-1 OS=Canis lupus familiaris GN=AP3B1 PE=2 SV=1 40 563 9.0E-59
sp|Q13367|AP3B2_HUMAN AP-3 complex subunit beta-2 OS=Homo sapiens GN=AP3B2 PE=1 SV=2 40 570 2.0E-57
sp|Q32PG1|AP3B1_BOVIN AP-3 complex subunit beta-1 OS=Bos taurus GN=AP3B1 PE=2 SV=1 40 563 2.0E-57
sp|Q9Z1T1|AP3B1_MOUSE AP-3 complex subunit beta-1 OS=Mus musculus GN=Ap3b1 PE=1 SV=2 40 570 4.0E-57
sp|Q9JME5|AP3B2_MOUSE AP-3 complex subunit beta-2 OS=Mus musculus GN=Ap3b2 PE=1 SV=2 40 570 4.0E-57
sp|O00203|AP3B1_HUMAN AP-3 complex subunit beta-1 OS=Homo sapiens GN=AP3B1 PE=1 SV=3 40 563 5.0E-57
sp|O13939|AP3B_SCHPO AP-3 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl6 PE=1 SV=1 43 551 4.0E-38
sp|Q556J8|AP3B_DICDI AP-3 complex subunit beta OS=Dictyostelium discoideum GN=ap3b-1 PE=3 SV=1 254 639 3.0E-28
sp|Q556J8|AP3B_DICDI AP-3 complex subunit beta OS=Dictyostelium discoideum GN=ap3b-1 PE=3 SV=1 15 234 4.0E-21
sp|Q759E2|AP3B_ASHGO AP-3 complex subunit beta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=APL6 PE=3 SV=2 40 537 6.0E-21
sp|P46682|AP3B_YEAST AP-3 complex subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL6 PE=1 SV=2 40 531 5.0E-18
sp|Q9M2T1|AP3BA_ARATH AP3-complex subunit beta-A OS=Arabidopsis thaliana GN=AP3BA PE=2 SV=2 253 574 7.0E-15
sp|Q8LPK4|AP2A2_ARATH AP-2 complex subunit alpha-2 OS=Arabidopsis thaliana GN=ALPHAC-AD PE=1 SV=1 33 552 2.0E-10
sp|Q8LPL6|AP2A1_ARATH AP-2 complex subunit alpha-1 OS=Arabidopsis thaliana GN=ALPHA-ADR PE=1 SV=1 33 552 3.0E-10
sp|P17426|AP2A1_MOUSE AP-2 complex subunit alpha-1 OS=Mus musculus GN=Ap2a1 PE=1 SV=1 15 554 8.0E-10
sp|P17427|AP2A2_MOUSE AP-2 complex subunit alpha-2 OS=Mus musculus GN=Ap2a2 PE=1 SV=2 15 554 9.0E-10
sp|P18484|AP2A2_RAT AP-2 complex subunit alpha-2 OS=Rattus norvegicus GN=Ap2a2 PE=1 SV=3 15 554 1.0E-09
sp|O95782|AP2A1_HUMAN AP-2 complex subunit alpha-1 OS=Homo sapiens GN=AP2A1 PE=1 SV=3 15 554 1.0E-09
sp|O94973|AP2A2_HUMAN AP-2 complex subunit alpha-2 OS=Homo sapiens GN=AP2A2 PE=1 SV=2 15 554 3.0E-09
sp|Q9ZUI6|AP1G2_ARATH AP-1 complex subunit gamma-2 OS=Arabidopsis thaliana GN=At1g60070 PE=1 SV=2 59 472 8.0E-09
sp|Q0VCK5|AP2A2_BOVIN AP-2 complex subunit alpha-2 OS=Bos taurus GN=AP2A2 PE=1 SV=1 15 554 2.0E-08
sp|P22892|AP1G1_MOUSE AP-1 complex subunit gamma-1 OS=Mus musculus GN=Ap1g1 PE=1 SV=3 90 495 5.0E-08
sp|O43747|AP1G1_HUMAN AP-1 complex subunit gamma-1 OS=Homo sapiens GN=AP1G1 PE=1 SV=5 90 495 6.0E-08
sp|P91926|AP2A_DROME AP-2 complex subunit alpha OS=Drosophila melanogaster GN=AP-2alpha PE=1 SV=1 33 463 6.0E-07
sp|Q7QG73|AP2A_ANOGA AP-2 complex subunit alpha OS=Anopheles gambiae GN=alpha-Adaptin PE=3 SV=4 33 463 1.0E-06
sp|Q29N38|AP2A_DROPS AP-2 complex subunit alpha OS=Drosophila pseudoobscura pseudoobscura GN=alpha-Adaptin PE=3 SV=1 33 463 2.0E-06
sp|Q5R5M2|AP1G1_PONAB AP-1 complex subunit gamma-1 OS=Pongo abelii GN=AP1G1 PE=2 SV=1 90 495 2.0E-06
sp|Q99128|AP1G1_USTMA AP-1 complex subunit gamma-1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=APL4 PE=3 SV=3 61 461 3.0E-06
sp|Q9UUF7|COPB_SCHPO Coatomer subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec26 PE=3 SV=1 10 460 7.0E-06
sp|O88512|AP1G2_MOUSE AP-1 complex subunit gamma-like 2 OS=Mus musculus GN=Ap1g2 PE=1 SV=2 59 461 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0030117 membrane coat Yes
GO:0006886 intracellular protein transport Yes
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0008150 biological_process No
GO:0098796 membrane protein complex No
GO:0046907 intracellular transport No
GO:0051649 establishment of localization in cell No
GO:0051641 cellular localization No
GO:0070727 cellular macromolecule localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0045184 establishment of protein localization No
GO:0006810 transport No
GO:0008104 protein localization No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0032991 protein-containing complex No
GO:0071702 organic substance transport No
GO:0015031 protein transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup4003
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|057780 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|057780
Rhodonia placenta FPRL280 RhoplFPRL280|378_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|057780
MSTPGQDAKFFQRGKIEELRTELLAAEAKDKKYVKRKTVLKRIVANITMGNDMSPLFNDVIQCLGTPLLEIKKMV
YLYLVSYGRSKPNQIHLVIPYFLQDVNDRNPLIRALAIRTMSYIPIPVVTESLTENLRHCLKDRDAYVRKTAAIC
VAKLYAADPRRAEKGGFVEMLRDLMLDGNATVVANAVAALSEIGDRQDGVIFKLNLATAHKLLSALEESSEWGQI
YILDSLLRYVPERHSDAEQMAERIIIQLQHANSAVVLTTIKALLYLMNYMESRKLIEHCCRKMGPPLVTLLSSGP
EVQYVALRNILLIIQRRPAVLKNDVKVFFCKYNDPIYVKLAKLEIMYRLARAENANEVLAELQEYATEVDIDFVR
KAVRSIGRLAIKVEPAADKSIEALLNLLENKVSYVAQEAVIVIKDVFRRYPGKYEGVIPTLCNHLDLMDEPESKA
AMIWILGQYANRIDNADELIDVLLDSFLTEAVEVQLALLTAAVKLFIYKSGSESAKEIVHKVLKWATEDVDNPDL
RDRGFMYWRMLAINPTFAGEIVLAEKPPITTDSDRMDRGALDQLLLHTGTISSIYHKNPETFIRNAVGKALVDSP
ALNANSRAVLVMLPRLQLPDAPIVVPGPGPQEPNARQDPAPPVPPSKSSPEPRDATDVDDQDEGDSDHDDIPDPS
RSGDPYSSLGDAFKDYLTDRPQPIVTTNRQRHNEEDLMF*
Coding >AgabiH39|057780
ATGTCAACACCCGGCCAGGATGCCAAGTTTTTTCAAAGAGGGAAAATTGAGGAACTTCGAACAGAGTTGCTGGCC
GCAGAAGCGAAAGACAAGAAATATGTGAAGAGGAAAACAGTCTTGAAGCGGATTGTGGCTAATATCACAATGGGG
AATGACATGTCCCCCCTTTTCAACGACGTTATCCAATGCCTTGGGACACCTCTACTAGAAATCAAGAAAATGGTA
TACCTCTACCTCGTCAGCTATGGCCGCTCGAAACCGAACCAGATCCACCTTGTCATTCCATATTTCCTACAGGAC
GTCAACGACCGAAATCCATTAATCCGGGCTTTGGCGATACGCACCATGTCCTATATTCCAATCCCCGTCGTCACG
GAATCTCTCACGGAAAACCTTCGACATTGTCTAAAGGATCGTGACGCATACGTTCGAAAAACAGCTGCAATATGT
GTAGCCAAACTCTATGCTGCGGATCCTCGCAGAGCGGAAAAAGGAGGTTTCGTTGAGATGCTACGAGACCTCATG
TTGGATGGCAATGCGACTGTCGTAGCAAACGCCGTGGCAGCCCTTTCCGAAATCGGGGATCGCCAGGATGGCGTG
ATATTCAAGCTAAATCTTGCAACTGCACATAAATTATTGAGTGCTTTAGAGGAGAGCTCTGAATGGGGACAAATT
TATATTTTGGATTCTTTACTGCGTTATGTTCCTGAGCGTCATTCTGATGCAGAACAAATGGCCGAACGTATCATT
ATTCAGCTGCAACATGCCAACTCTGCGGTAGTCTTGACCACTATCAAAGCTCTCCTCTACTTGATGAATTATATG
GAAAGCCGAAAGCTGATTGAACATTGTTGTCGGAAAATGGGACCTCCTCTTGTCACTCTACTCTCATCCGGCCCT
GAAGTGCAATACGTAGCTCTCAGGAACATTTTACTAATCATCCAAAGGCGGCCTGCCGTGTTAAAGAACGATGTC
AAAGTCTTCTTCTGCAAATACAATGACCCCATATACGTGAAGCTGGCCAAACTCGAGATCATGTACCGTTTAGCT
CGTGCGGAAAACGCAAACGAAGTCTTGGCAGAACTACAGGAGTATGCAACTGAAGTGGATATCGACTTCGTTCGT
AAAGCAGTGAGATCCATAGGCCGACTGGCGATCAAGGTGGAGCCGGCCGCCGACAAAAGTATTGAGGCGTTGCTG
AATCTACTCGAAAACAAAGTATCATATGTGGCCCAAGAGGCCGTCATTGTAATCAAGGATGTCTTCAGAAGATAC
CCCGGAAAGTATGAAGGCGTCATACCCACACTTTGCAACCATTTGGACTTAATGGACGAACCGGAATCCAAGGCA
GCGATGATCTGGATTTTGGGTCAATACGCCAACAGAATCGACAACGCTGATGAACTGATTGATGTACTCTTGGAT
AGTTTTCTGACCGAGGCCGTTGAGGTGCAACTTGCTCTGTTAACGGCTGCAGTGAAACTCTTCATTTATAAATCA
GGATCTGAGTCCGCCAAAGAGATCGTCCATAAAGTGTTAAAGTGGGCGACGGAAGACGTCGATAATCCAGACCTA
CGAGACAGGGGTTTCATGTACTGGCGAATGCTTGCCATCAATCCCACGTTTGCAGGGGAAATTGTACTCGCTGAG
AAGCCTCCAATTACGACCGATTCAGACAGGATGGATAGAGGTGCTTTAGACCAGCTGTTATTGCATACTGGAACG
ATTAGCAGTATATACCACAAGAATCCCGAGACCTTTATCCGGAATGCTGTTGGGAAGGCGCTGGTGGATAGCCCA
GCATTGAATGCTAATTCACGCGCAGTCCTGGTGATGCTTCCCCGACTTCAACTTCCGGATGCGCCCATAGTTGTA
CCTGGACCTGGACCTCAGGAACCTAACGCACGACAAGATCCTGCTCCTCCGGTCCCGCCCTCTAAATCATCCCCA
GAACCTAGAGACGCGACCGACGTTGATGACCAGGATGAAGGAGATTCGGATCATGATGATATTCCAGATCCGTCG
AGATCGGGAGACCCGTATTCAAGTCTTGGAGACGCGTTCAAGGACTACTTGACTGATCGACCTCAGCCTATTGTT
ACTACCAACAGACAAAGACACAACGAAGAAGACCTGATGTTCTAA
Transcript >AgabiH39|057780
ATGTCAACACCCGGCCAGGATGCCAAGTTTTTTCAAAGAGGGAAAATTGAGGAACTTCGAACAGAGTTGCTGGCC
GCAGAAGCGAAAGACAAGAAATATGTGAAGAGGAAAACAGTCTTGAAGCGGATTGTGGCTAATATCACAATGGGG
AATGACATGTCCCCCCTTTTCAACGACGTTATCCAATGCCTTGGGACACCTCTACTAGAAATCAAGAAAATGGTA
TACCTCTACCTCGTCAGCTATGGCCGCTCGAAACCGAACCAGATCCACCTTGTCATTCCATATTTCCTACAGGAC
GTCAACGACCGAAATCCATTAATCCGGGCTTTGGCGATACGCACCATGTCCTATATTCCAATCCCCGTCGTCACG
GAATCTCTCACGGAAAACCTTCGACATTGTCTAAAGGATCGTGACGCATACGTTCGAAAAACAGCTGCAATATGT
GTAGCCAAACTCTATGCTGCGGATCCTCGCAGAGCGGAAAAAGGAGGTTTCGTTGAGATGCTACGAGACCTCATG
TTGGATGGCAATGCGACTGTCGTAGCAAACGCCGTGGCAGCCCTTTCCGAAATCGGGGATCGCCAGGATGGCGTG
ATATTCAAGCTAAATCTTGCAACTGCACATAAATTATTGAGTGCTTTAGAGGAGAGCTCTGAATGGGGACAAATT
TATATTTTGGATTCTTTACTGCGTTATGTTCCTGAGCGTCATTCTGATGCAGAACAAATGGCCGAACGTATCATT
ATTCAGCTGCAACATGCCAACTCTGCGGTAGTCTTGACCACTATCAAAGCTCTCCTCTACTTGATGAATTATATG
GAAAGCCGAAAGCTGATTGAACATTGTTGTCGGAAAATGGGACCTCCTCTTGTCACTCTACTCTCATCCGGCCCT
GAAGTGCAATACGTAGCTCTCAGGAACATTTTACTAATCATCCAAAGGCGGCCTGCCGTGTTAAAGAACGATGTC
AAAGTCTTCTTCTGCAAATACAATGACCCCATATACGTGAAGCTGGCCAAACTCGAGATCATGTACCGTTTAGCT
CGTGCGGAAAACGCAAACGAAGTCTTGGCAGAACTACAGGAGTATGCAACTGAAGTGGATATCGACTTCGTTCGT
AAAGCAGTGAGATCCATAGGCCGACTGGCGATCAAGGTGGAGCCGGCCGCCGACAAAAGTATTGAGGCGTTGCTG
AATCTACTCGAAAACAAAGTATCATATGTGGCCCAAGAGGCCGTCATTGTAATCAAGGATGTCTTCAGAAGATAC
CCCGGAAAGTATGAAGGCGTCATACCCACACTTTGCAACCATTTGGACTTAATGGACGAACCGGAATCCAAGGCA
GCGATGATCTGGATTTTGGGTCAATACGCCAACAGAATCGACAACGCTGATGAACTGATTGATGTACTCTTGGAT
AGTTTTCTGACCGAGGCCGTTGAGGTGCAACTTGCTCTGTTAACGGCTGCAGTGAAACTCTTCATTTATAAATCA
GGATCTGAGTCCGCCAAAGAGATCGTCCATAAAGTGTTAAAGTGGGCGACGGAAGACGTCGATAATCCAGACCTA
CGAGACAGGGGTTTCATGTACTGGCGAATGCTTGCCATCAATCCCACGTTTGCAGGGGAAATTGTACTCGCTGAG
AAGCCTCCAATTACGACCGATTCAGACAGGATGGATAGAGGTGCTTTAGACCAGCTGTTATTGCATACTGGAACG
ATTAGCAGTATATACCACAAGAATCCCGAGACCTTTATCCGGAATGCTGTTGGGAAGGCGCTGGTGGATAGCCCA
GCATTGAATGCTAATTCACGCGCAGTCCTGGTGATGCTTCCCCGACTTCAACTTCCGGATGCGCCCATAGTTGTA
CCTGGACCTGGACCTCAGGAACCTAACGCACGACAAGATCCTGCTCCTCCGGTCCCGCCCTCTAAATCATCCCCA
GAACCTAGAGACGCGACCGACGTTGATGACCAGGATGAAGGAGATTCGGATCATGATGATATTCCAGATCCGTCG
AGATCGGGAGACCCGTATTCAAGTCTTGGAGACGCGTTCAAGGACTACTTGACTGATCGACCTCAGCCTATTGTT
ACTACCAACAGACAAAGACACAACGAAGAAGACCTGATGTTCTAA
Gene >AgabiH39|057780
ATGTCAACACCCGGCCAGGATGCCAAGTTTTTTCAAAGAGGGAAAATTGAGGTACTTAATATCATTAATCCGCGC
TCCGTCTATCTATCTACCCCTAAAATCTAGGAACTTCGAACAGAGTTGCTGGCCGCAGAAGCGAAAGACAAGAAA
TATGTGAAGAGGAAAACAGTCTTGAAGCGGATTGTGGCTAATATCACAATGGGGAATGACAGTGGGTACTTTATG
GCACGGCCAGGCCTGTTACGGGCTGATACGCGTCTACCTGACAGTGTCCCCCCTTTTCAACGACGTTATCCAATG
CCTTGGGACACCTCTACTAGAAATCAAGAAAAGTGAGCCGCTACATCACTTAGGCCTCTGTCCTTGGGATTCTTA
GGGCAAACATCAGTGGTATACCTCTACCTCGTCAGCTATGGCCGCTCGAAACCGAACCAGATCCACCTTGTCATT
CCATATTTCCTACAGGTGGGCTTCATCAATCTGCATCCGTATGTGTTTTCAACGAGCCACAGGACGTCAACGACC
GAAATCCATTAATCCGGGCTTTGGCGATACGCACCATGTCCTATATTCCAATCCCCGTCGTCACGGAATCTCTCA
CGGAAAACCTTCGACATTGTCTAAAGGATCGTGACGCATACGTTCGAAAAACAGCTGCAATATGTGTAGCCAAAC
TCTATGCTGCGGATCCTCGCAGAGCGGAAAAAGGAGGTTTCGTTGAGATGCTACGAGACCTCATGTTGGATGGCA
ATGCGACTGTCGTAGCAAACGCCGTGGCAGCCCTTTCCGAAATCGGGGATCGCCAGGATGGCGTGATATTCAAGC
TAAATCTTGCAACTGCACATAAATTATTGAGTGCTTTAGAGGAGAGCTCTGAGTGCGTGACCTTATCATTTCTTG
AATTATCCCACTCATGTCCCCCAGATGGGGACAAATTTATATTTTGGATTCTTTACTGCGTTATGTTCCTGAGCG
TCATTCTGATGCAGAACAAATGGCCGAACGTATCATTATTCAGCTGCAACATGCCAACTCTGCGGTAGTCTTGAC
CACTATCAAAGCTCTCCTCTACTTGATGAATTATATGGAAAGCCGAAAGCTGATTGAACATTGTTGTCGGAAAAT
GGGACCTCCTCTTGGTAAGTGTTCAACTACTCTCAATTCCTTATGAGACGTCGATTAATTCCATCAACCTAGTCA
CTCTACTCTCATCCGGCCCTGAAGTGCAATACGTAGCTCTCAGGAACATTTTACTAATCATCCAAAGGCGGCCTG
CCGTGTTAAAGAACGATGTCAAAGTCTTCTTCTGCAAATACAATGACCCCATATACGTGAAGCTGGCCAAACTCG
AGATCATGTACCGTTTAGCTCGTGCGGAAAACGCAAACGAAGTCTTGGCAGAACTACAGGAGTAAGTCCATGATT
ACACACTCGGTATTTGTATAAAGACGAATGCAGGTATGCAACTGAAGTGGATATCGACTTCGTTCGTAAAGCAGT
GAGATCCATAGGCCGACTGGCGATCAAGGTGGAGCCGGCCGCCGACAAAAGTATTGAGGCGTTGCTGAATCTACT
CGAAAACAAAGTATCATATGTGGCCCAAGAGGCCGTCATTGTAATCAAGGATGTCTTCAGAAGATACCCCGGAAA
GTATGAAGGCGTCATACCCACACTTTGCAACCATTTGGACTTAATGGACGAACCGGAATCCAAGGCAGCGATGAT
CTGGATTTTGGGTCAATACGCCAACAGAATCGACAACGCTGATGAACTGATTGATGTACTCTTGGATAGTTTTCT
GACCGAGGCCGTTGAGGTTAGCACTGTTGTCCTCCCTCCCTCCGTAATGAATGCTGAAAGCCCTCCAAGGTGCAA
CTTGCTCTGTTAACGGCTGCAGTGAAACTCTTCATTTATAAATCAGGATCTGAGTCCGCCAAAGAGATCGTCCAT
AAAGTGTTAAAGTGGGCGACGGAAGACGTCGATAATCCAGACCTACGAGACAGGGGTTTCATGTACTGGCGAATG
CTTGCCATCAATCCCACGTTTGCAGGGGAAATTGTACTCGCTGAGAAGCCTCCAATTACGACCGATTCAGACAGG
ATGGATAGAGGTGCTTTAGACCAGCTGTTATTGCATACTGGAACGATTAGCAGTATATACCACAAGAATCCCGAG
GTAAAACAATATTCCCGCTCTTTGATGATGCATTTGGCTGACTCTGCCAGACCTTTATCCGGAATGCTGTTGGGA
AGGCGCTGGTGGATAGCCCAGCATTGAATGCTAATTCACGCGCAGTCCTGGTGATGCTTCCCCGACTTCAACTTC
CGGATGCGCCCATAGTTGTACCTGGACCTGGACCTCAGGAACCTAACGCACGACAAGATCCTGCTCCTCCGGTCC
CGCCCTCTAAATCATCCCCAGAACCTAGAGACGCGACCGACGTTGATGACCAGGATGAAGGAGATTCGGATCATG
ATGATATTCCAGATCCGTCGAGATCGGGAGACCCGTATTCAAGTCTTGGAGACGCGTTCAAGGACTACTTGACTG
ATCGACCTCAGCCTATTGTTACTACCAACAGACAAAGACACAACGAAGAAGACCTGATGTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail