Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|054520
Gene name
Locationscaffold_03:502499..505414
Strand-
Gene length (bp)2915
Transcript length (bp)2613
Coding sequence length (bp)2613
Protein length (aa) 871

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06602 Myotub-related Myotubularin-like phosphatase domain 4.2E-151 106 510

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13819|YMR1_SCHPO Phosphoinositide 3-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.03 PE=3 SV=1 1 585 1.0E-157
sp|P47147|YMR1_YEAST Phosphoinositide 3-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR1 PE=1 SV=1 1 588 1.0E-125
sp|Q9Y217|MTMR6_HUMAN Myotubularin-related protein 6 OS=Homo sapiens GN=MTMR6 PE=1 SV=3 1 603 2.0E-114
sp|Q96EF0|MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens GN=MTMR8 PE=1 SV=1 1 640 2.0E-113
sp|Q8VE11|MTMR6_MOUSE Myotubularin-related protein 6 OS=Mus musculus GN=Mtmr6 PE=1 SV=1 1 605 8.0E-113
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13819|YMR1_SCHPO Phosphoinositide 3-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.03 PE=3 SV=1 1 585 1.0E-157
sp|P47147|YMR1_YEAST Phosphoinositide 3-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR1 PE=1 SV=1 1 588 1.0E-125
sp|Q9Y217|MTMR6_HUMAN Myotubularin-related protein 6 OS=Homo sapiens GN=MTMR6 PE=1 SV=3 1 603 2.0E-114
sp|Q96EF0|MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens GN=MTMR8 PE=1 SV=1 1 640 2.0E-113
sp|Q8VE11|MTMR6_MOUSE Myotubularin-related protein 6 OS=Mus musculus GN=Mtmr6 PE=1 SV=1 1 605 8.0E-113
sp|Q5F452|MTMR8_CHICK Myotubularin-related protein 8 OS=Gallus gallus GN=MTMR8 PE=2 SV=1 1 664 2.0E-112
sp|Q9Y216|MTMR7_HUMAN Myotubularin-related protein 7 OS=Homo sapiens GN=MTMR7 PE=1 SV=3 1 587 7.0E-111
sp|Q5R6F6|MTMR7_PONAB Myotubularin-related protein 7 OS=Pongo abelii GN=MTMR7 PE=2 SV=1 1 587 4.0E-110
sp|Q6TEL0|MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio GN=mtmr8 PE=2 SV=1 1 661 7.0E-110
sp|Q9Z2C9|MTMR7_MOUSE Myotubularin-related protein 7 OS=Mus musculus GN=Mtmr7 PE=1 SV=2 1 587 2.0E-109
sp|Q13614|MTMR2_HUMAN Myotubularin-related protein 2 OS=Homo sapiens GN=MTMR2 PE=1 SV=4 22 535 9.0E-97
sp|A6QLT2|MTMR2_BOVIN Myotubularin-related protein 2 OS=Bos taurus GN=MTMR2 PE=2 SV=1 22 535 3.0E-96
sp|Q5REB9|MTMR2_PONAB Myotubularin-related protein 2 OS=Pongo abelii GN=MTMR2 PE=2 SV=1 22 535 5.0E-96
sp|Q9Z2D1|MTMR2_MOUSE Myotubularin-related protein 2 OS=Mus musculus GN=Mtmr2 PE=1 SV=3 22 535 6.0E-96
sp|Q13496|MTM1_HUMAN Myotubularin OS=Homo sapiens GN=MTM1 PE=1 SV=2 106 579 5.0E-94
sp|Q5R9S3|MTM1_PONAB Myotubularin OS=Pongo abelii GN=MTM1 PE=2 SV=1 106 579 5.0E-94
sp|Q9Z2C5|MTM1_MOUSE Myotubularin OS=Mus musculus GN=Mtm1 PE=1 SV=2 106 636 2.0E-93
sp|Q5ZIV1|MTMR2_CHICK Myotubularin-related protein 2 OS=Gallus gallus GN=MTMR2 PE=2 SV=1 22 535 4.0E-93
sp|A0JMK5|MTMR2_DANRE Myotubularin-related protein 2 OS=Danio rerio GN=mtmr2 PE=2 SV=2 22 535 2.0E-92
sp|Q6AXQ4|MTM1_RAT Myotubularin OS=Rattus norvegicus GN=Mtm1 PE=2 SV=2 22 628 2.0E-91
sp|A6QLT4|MTM1_BOVIN Myotubularin OS=Bos taurus GN=MTM1 PE=2 SV=2 4 579 1.0E-88
sp|Q52KU6|MTM1_XENLA Myotubularin OS=Xenopus laevis GN=mtm1 PE=2 SV=1 22 604 2.0E-88
sp|Q5EB32|MTM1_XENTR Myotubularin OS=Xenopus tropicalis GN=mtm1 PE=2 SV=1 22 604 4.0E-88
sp|Q9Z2D0|MTMR9_MOUSE Myotubularin-related protein 9 OS=Mus musculus GN=Mtmr9 PE=1 SV=2 2 579 8.0E-87
sp|Q9Z2C4|MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus GN=Mtmr1 PE=1 SV=1 23 532 2.0E-84
sp|Q96QG7|MTMR9_HUMAN Myotubularin-related protein 9 OS=Homo sapiens GN=MTMR9 PE=1 SV=1 2 579 2.0E-84
sp|Q13613|MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo sapiens GN=MTMR1 PE=1 SV=4 23 532 1.0E-83
sp|F4JWB3|MYTM2_ARATH Phosphatidylinositol-3-phosphatase myotubularin-2 OS=Arabidopsis thaliana GN=MTM2 PE=1 SV=1 144 550 1.0E-77
sp|Q91XS1|MTMR4_MOUSE Myotubularin-related protein 4 OS=Mus musculus GN=Mtmr4 PE=1 SV=1 131 532 4.0E-74
sp|Q5PQT2|MTMR3_RAT Myotubularin-related protein 3 OS=Rattus norvegicus GN=Mtmr3 PE=1 SV=1 129 539 5.0E-74
sp|Q13615|MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens GN=MTMR3 PE=1 SV=3 129 539 9.0E-74
sp|Q9NYA4|MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens GN=MTMR4 PE=1 SV=2 131 549 1.0E-73
sp|Q8K296|MTMR3_MOUSE Myotubularin-related protein 3 OS=Mus musculus GN=Mtmr3 PE=1 SV=2 129 539 1.0E-72
sp|F4J3T8|MYTM1_ARATH Phosphatidylinositol-3-phosphatase myotubularin-1 OS=Arabidopsis thaliana GN=MTM1 PE=1 SV=1 80 552 5.0E-72
sp|Q7ZXF1|MTMR4_XENLA Myotubularin-related protein 4 OS=Xenopus laevis GN=mtmr4 PE=2 SV=1 131 539 1.0E-69
sp|Q54GQ1|MTMR_DICDI Myotubularin-related protein DDB_G0290005 OS=Dictyostelium discoideum GN=DDB_G0290005 PE=3 SV=2 67 577 1.0E-66
sp|Q2KJ24|MTMR9_BOVIN Myotubularin-related protein 9 OS=Bos taurus GN=MTMR9 PE=2 SV=1 22 579 1.0E-65
sp|Q22712|MTMR3_CAEEL Myotubularin-related protein 3 OS=Caenorhabditis elegans GN=mtm-3 PE=1 SV=2 131 582 7.0E-57
sp|Q86WG5|MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens GN=SBF2 PE=1 SV=1 131 566 3.0E-32
sp|Q6NTN5|MTMRD_XENLA Myotubularin-related protein 13 OS=Xenopus laevis GN=sbf2 PE=2 SV=1 329 509 2.0E-27
sp|O95248|MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens GN=SBF1 PE=1 SV=3 329 574 2.0E-27
sp|Q6ZPE2|MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus GN=Sbf1 PE=1 SV=2 329 531 4.0E-27
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 333 529 3.0E-26
sp|A2BGG1|MTMRC_DANRE Myotubularin-related protein 12 OS=Danio rerio GN=mtmr12 PE=3 SV=1 72 535 4.0E-23
sp|Q9NXD2|MTMRA_HUMAN Myotubularin-related protein 10 OS=Homo sapiens GN=MTMR10 PE=1 SV=3 143 509 2.0E-21
sp|Q7TPM9|MTMRA_MOUSE Myotubularin-related protein 10 OS=Mus musculus GN=Mtmr10 PE=1 SV=2 143 509 9.0E-20
sp|Q80TA6|MTMRC_MOUSE Myotubularin-related protein 12 OS=Mus musculus GN=Mtmr12 PE=1 SV=2 331 556 5.0E-19
sp|Q5FVM6|MTMRC_RAT Myotubularin-related protein 12 OS=Rattus norvegicus GN=Mtmr12 PE=1 SV=2 331 556 5.0E-19
sp|Q5U581|MTRAA_XENLA Myotubularin-related protein 10-A OS=Xenopus laevis GN=mtmr10-a PE=2 SV=1 144 509 1.0E-18
sp|Q9C0I1|MTMRC_HUMAN Myotubularin-related protein 12 OS=Homo sapiens GN=MTMR12 PE=1 SV=2 331 555 2.0E-18
sp|Q6NU08|MTRAB_XENLA Myotubularin-related protein 10-B OS=Xenopus laevis GN=mtmr10-b PE=2 SV=1 144 529 3.0E-18
sp|Q5R989|MTMRC_PONAB Myotubularin-related protein 12 OS=Pongo abelii GN=MTMR12 PE=2 SV=1 331 555 6.0E-18
sp|A0JMF6|MTMRA_DANRE Myotubularin-related protein 10 OS=Danio rerio GN=mtmr10 PE=2 SV=1 144 509 2.0E-16
sp|A4FU01|MTMRB_HUMAN Myotubularin-related protein 11 OS=Homo sapiens GN=MTMR11 PE=2 SV=2 330 546 5.0E-09
sp|Q3V1L6|MTMRB_MOUSE Myotubularin-related protein 11 OS=Mus musculus GN=Mtmr11 PE=2 SV=1 142 567 3.0E-08
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 458 531 1.0E-07
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 329 408 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup3883
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|054520 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|054520
Rhodonia placenta FPRL280 RhoplFPRL280|117_16

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|054520
MDAIRVPKVEHVTINKSGITSRGTLHLTAHHLIFRYDDDKLEEMWVTYPLISLVNRLPQTLSGQSPLSFHTRTFE
TFTLFFPREDEASDVFESVKELTVTISVTQLYAFIYRPNPPFPNNDGWSIYSPREEFGRMGLGTRIKAWRFTEVN
KDYAFCPTYPAKLVVPTRISDTTLQYASKYRSKCRIPVLSYLHWANYGSITRSSQPMVGITQNRSIQDEKLIEAI
FQTHVSPDTRVSSGPVYGATTTNLIIDARPTANAMANTAKGAGTENMDHYKDARKAYLGIDHIHTMRESLAKVVE
ALREADAMLTSINSDLSGQVSGISVLDRQALRRSGWLRHIRAIIEGTVLISRNIHVNSSHVLIHCSDGWDRTSQL
SSLSQLCLDPYYRTIKGFEILIEKDWLSFGHKFLDRCGHLSSEKFFVSPIENPGSGSGTDAAQAFLASVQNRFAS
QQHIKETSPVFHQFLESVRQVQRQFPTRFEFNERFLRQLYYHLYSCQFGTFLFNNEKERKTTNGLELPLSERTCS
VWDFFNSPAEMEKNRNSDYDPSLDDPLNRGSGADMGVLFPNPKDMRFWNELYGRTDEEMNGRIIMATSKPEELLD
VEDDVSIPRMATPSNDPMPPSPNAAPAPIPALTTQSLGTPYPIRTPSPSAVGRVTSTGSSATSSGPPPSADIYSL
SASSSSQSPSPHQRGKPDFLGGAGIGVRSVWGRLSSNASTAFSAVQGAYAGVAKDLGKRVGGNEDEVPVKTAEMH
TREMLSAWGEAPADPLTSQVTSSFSAMSVGNNPWAPGQRDVNTLASSRDENPWSDSTVSQQKFPVLSTDLSSSLP
LDPTIPTPLRRMAASPTIQKKDIAQPIKDPPENPGGTDPLGVGPL*
Coding >AgabiH39|054520
ATGGACGCTATAAGGGTACCAAAAGTTGAACACGTTACAATAAACAAATCTGGCATTACGTCGAGAGGAACTTTG
CATCTTACAGCACACCACCTAATATTTCGTTACGACGATGATAAACTTGAGGAAATGTGGGTAACCTACCCTTTG
ATCTCGCTGGTCAATCGGCTCCCGCAGACTTTGAGTGGGCAGTCGCCGTTAAGCTTCCATACTCGCACATTCGAA
ACCTTTACTTTATTCTTTCCGAGGGAAGATGAAGCATCTGATGTTTTTGAGAGCGTAAAAGAGCTGACAGTCACA
ATTTCGGTCACTCAGCTGTACGCTTTCATTTATAGACCGAATCCACCGTTTCCCAACAATGATGGGTGGTCCATA
TATTCTCCTCGTGAAGAATTTGGGAGGATGGGATTGGGCACAAGAATCAAGGCATGGAGATTTACGGAGGTCAAC
AAGGATTACGCATTTTGCCCGACATACCCAGCAAAACTCGTTGTGCCGACTAGGATCAGTGACACTACCCTGCAG
TATGCTTCGAAATACCGGAGTAAATGCCGAATACCAGTATTAAGTTATTTGCACTGGGCGAATTATGGAAGCATA
ACACGGTCAAGTCAGCCAATGGTCGGAATCACACAAAACCGGTCAATCCAGGATGAAAAGCTTATTGAGGCCATC
TTTCAAACACACGTATCTCCCGATACACGCGTATCCAGTGGGCCAGTATATGGAGCTACTACGACCAACCTCATC
ATTGACGCACGACCTACGGCAAATGCAATGGCAAACACTGCCAAAGGTGCGGGGACGGAAAATATGGACCATTAC
AAGGACGCGAGGAAGGCCTATCTCGGGATAGATCACATTCACACAATGCGGGAGTCGCTGGCCAAAGTAGTCGAG
GCACTACGTGAGGCCGATGCTATGCTCACCAGCATCAATAGCGATTTGTCTGGTCAAGTCTCAGGAATATCTGTG
TTGGACAGGCAAGCACTACGACGATCCGGTTGGCTGCGACATATACGAGCGATCATTGAAGGCACAGTCTTGATA
TCTCGAAATATCCATGTCAATTCGTCCCACGTTCTCATACACTGTTCTGACGGCTGGGATAGAACATCCCAGTTG
TCCTCTTTGTCTCAACTATGCCTCGATCCATACTATCGTACGATCAAAGGTTTCGAAATCTTGATTGAAAAGGAC
TGGCTCTCGTTTGGCCACAAGTTTCTTGATAGGTGTGGGCACCTTTCCTCTGAAAAGTTTTTTGTTTCTCCGATA
GAAAATCCAGGGTCTGGCAGTGGAACGGATGCTGCTCAGGCCTTTCTGGCATCGGTTCAAAATCGCTTTGCCTCA
CAACAGCATATCAAGGAAACGAGCCCCGTCTTTCATCAATTTTTAGAATCTGTCCGGCAAGTCCAGAGACAATTC
CCGACAAGGTTCGAGTTCAACGAACGCTTCCTTCGACAACTCTATTATCACCTGTATTCGTGCCAGTTTGGTACG
TTCCTGTTCAACAACGAAAAGGAAAGAAAGACGACAAATGGACTTGAACTGCCGCTTTCTGAGAGAACGTGCAGT
GTCTGGGATTTCTTCAATTCTCCCGCTGAGATGGAGAAAAATCGGAACTCGGATTACGATCCCTCCCTTGATGAT
CCACTGAATCGTGGGTCAGGCGCTGATATGGGGGTGCTTTTCCCCAATCCCAAGGATATGCGATTTTGGAACGAG
CTGTATGGTCGTACAGACGAGGAAATGAATGGGAGAATCATAATGGCAACTTCGAAGCCTGAGGAATTATTAGAC
GTCGAGGATGATGTTAGTATTCCCCGCATGGCAACGCCTTCAAATGATCCTATGCCACCGTCACCAAATGCGGCG
CCTGCTCCCATTCCAGCATTAACGACGCAGTCGCTTGGTACTCCTTACCCTATACGTACACCCTCCCCGTCAGCA
GTCGGTAGGGTCACCTCTACAGGGTCATCAGCCACATCGTCTGGGCCGCCACCAAGTGCAGATATCTATTCCTTG
TCAGCTTCCTCTTCTTCACAGTCCCCGAGCCCGCATCAGCGGGGAAAGCCAGACTTTCTGGGTGGAGCAGGGATA
GGAGTTAGATCAGTATGGGGAAGATTGTCTTCTAATGCCTCAACGGCTTTTTCTGCAGTCCAGGGAGCGTATGCT
GGAGTAGCTAAGGATTTGGGAAAACGAGTTGGGGGAAATGAAGATGAAGTTCCAGTAAAGACGGCGGAAATGCAT
ACTCGAGAGATGCTCAGTGCATGGGGGGAAGCCCCGGCAGATCCGTTGACGTCTCAGGTCACTTCGTCTTTCTCT
GCTATGTCTGTTGGTAACAATCCATGGGCGCCGGGGCAACGGGACGTAAATACCTTGGCTTCATCACGGGATGAG
AATCCTTGGAGTGATTCTACCGTGTCACAGCAAAAATTTCCTGTCTTATCGACTGATCTATCAAGCTCGCTTCCG
CTTGATCCTACCATCCCTACACCGCTGCGTAGAATGGCAGCATCACCGACAATTCAAAAGAAAGACATAGCTCAA
CCCATCAAAGACCCACCCGAGAATCCGGGAGGGACAGATCCCCTAGGCGTTGGACCACTATAA
Transcript >AgabiH39|054520
ATGGACGCTATAAGGGTACCAAAAGTTGAACACGTTACAATAAACAAATCTGGCATTACGTCGAGAGGAACTTTG
CATCTTACAGCACACCACCTAATATTTCGTTACGACGATGATAAACTTGAGGAAATGTGGGTAACCTACCCTTTG
ATCTCGCTGGTCAATCGGCTCCCGCAGACTTTGAGTGGGCAGTCGCCGTTAAGCTTCCATACTCGCACATTCGAA
ACCTTTACTTTATTCTTTCCGAGGGAAGATGAAGCATCTGATGTTTTTGAGAGCGTAAAAGAGCTGACAGTCACA
ATTTCGGTCACTCAGCTGTACGCTTTCATTTATAGACCGAATCCACCGTTTCCCAACAATGATGGGTGGTCCATA
TATTCTCCTCGTGAAGAATTTGGGAGGATGGGATTGGGCACAAGAATCAAGGCATGGAGATTTACGGAGGTCAAC
AAGGATTACGCATTTTGCCCGACATACCCAGCAAAACTCGTTGTGCCGACTAGGATCAGTGACACTACCCTGCAG
TATGCTTCGAAATACCGGAGTAAATGCCGAATACCAGTATTAAGTTATTTGCACTGGGCGAATTATGGAAGCATA
ACACGGTCAAGTCAGCCAATGGTCGGAATCACACAAAACCGGTCAATCCAGGATGAAAAGCTTATTGAGGCCATC
TTTCAAACACACGTATCTCCCGATACACGCGTATCCAGTGGGCCAGTATATGGAGCTACTACGACCAACCTCATC
ATTGACGCACGACCTACGGCAAATGCAATGGCAAACACTGCCAAAGGTGCGGGGACGGAAAATATGGACCATTAC
AAGGACGCGAGGAAGGCCTATCTCGGGATAGATCACATTCACACAATGCGGGAGTCGCTGGCCAAAGTAGTCGAG
GCACTACGTGAGGCCGATGCTATGCTCACCAGCATCAATAGCGATTTGTCTGGTCAAGTCTCAGGAATATCTGTG
TTGGACAGGCAAGCACTACGACGATCCGGTTGGCTGCGACATATACGAGCGATCATTGAAGGCACAGTCTTGATA
TCTCGAAATATCCATGTCAATTCGTCCCACGTTCTCATACACTGTTCTGACGGCTGGGATAGAACATCCCAGTTG
TCCTCTTTGTCTCAACTATGCCTCGATCCATACTATCGTACGATCAAAGGTTTCGAAATCTTGATTGAAAAGGAC
TGGCTCTCGTTTGGCCACAAGTTTCTTGATAGGTGTGGGCACCTTTCCTCTGAAAAGTTTTTTGTTTCTCCGATA
GAAAATCCAGGGTCTGGCAGTGGAACGGATGCTGCTCAGGCCTTTCTGGCATCGGTTCAAAATCGCTTTGCCTCA
CAACAGCATATCAAGGAAACGAGCCCCGTCTTTCATCAATTTTTAGAATCTGTCCGGCAAGTCCAGAGACAATTC
CCGACAAGGTTCGAGTTCAACGAACGCTTCCTTCGACAACTCTATTATCACCTGTATTCGTGCCAGTTTGGTACG
TTCCTGTTCAACAACGAAAAGGAAAGAAAGACGACAAATGGACTTGAACTGCCGCTTTCTGAGAGAACGTGCAGT
GTCTGGGATTTCTTCAATTCTCCCGCTGAGATGGAGAAAAATCGGAACTCGGATTACGATCCCTCCCTTGATGAT
CCACTGAATCGTGGGTCAGGCGCTGATATGGGGGTGCTTTTCCCCAATCCCAAGGATATGCGATTTTGGAACGAG
CTGTATGGTCGTACAGACGAGGAAATGAATGGGAGAATCATAATGGCAACTTCGAAGCCTGAGGAATTATTAGAC
GTCGAGGATGATGTTAGTATTCCCCGCATGGCAACGCCTTCAAATGATCCTATGCCACCGTCACCAAATGCGGCG
CCTGCTCCCATTCCAGCATTAACGACGCAGTCGCTTGGTACTCCTTACCCTATACGTACACCCTCCCCGTCAGCA
GTCGGTAGGGTCACCTCTACAGGGTCATCAGCCACATCGTCTGGGCCGCCACCAAGTGCAGATATCTATTCCTTG
TCAGCTTCCTCTTCTTCACAGTCCCCGAGCCCGCATCAGCGGGGAAAGCCAGACTTTCTGGGTGGAGCAGGGATA
GGAGTTAGATCAGTATGGGGAAGATTGTCTTCTAATGCCTCAACGGCTTTTTCTGCAGTCCAGGGAGCGTATGCT
GGAGTAGCTAAGGATTTGGGAAAACGAGTTGGGGGAAATGAAGATGAAGTTCCAGTAAAGACGGCGGAAATGCAT
ACTCGAGAGATGCTCAGTGCATGGGGGGAAGCCCCGGCAGATCCGTTGACGTCTCAGGTCACTTCGTCTTTCTCT
GCTATGTCTGTTGGTAACAATCCATGGGCGCCGGGGCAACGGGACGTAAATACCTTGGCTTCATCACGGGATGAG
AATCCTTGGAGTGATTCTACCGTGTCACAGCAAAAATTTCCTGTCTTATCGACTGATCTATCAAGCTCGCTTCCG
CTTGATCCTACCATCCCTACACCGCTGCGTAGAATGGCAGCATCACCGACAATTCAAAAGAAAGACATAGCTCAA
CCCATCAAAGACCCACCCGAGAATCCGGGAGGGACAGATCCCCTAGGCGTTGGACCACTATAA
Gene >AgabiH39|054520
ATGGACGCTATAAGGGTACCAAAAGTATGTAACATACCGTGCGGTCTCATTTTCGAGACCCGCGACCATGATTGA
TAGCCAAGGTTCACCTAGGTTGAACACGTTACAATAAACAAATCTGGCATTACGTCGAGAGGAACTTTGCATCTT
ACAGCACACCACCTAATATTTCGTTACGACGATGATAAACTTGAGGAAATGTGGGTAAGTTGGATGCGTACTCAA
TCTGACGAGTTTTTTGTCTTATCAGACTTTAATTCATTCGATTGACGTGTAGGTAACCTACCCTTTGATCTCGCT
GGTCAATCGGCTCCCGCAGACTTTGAGTGGGCAGTCGCCGTTAAGCTTCCATACTCGCACATTCGAAACCTTTAC
TTTATTCTTTCCGAGGGAAGATGAAGCATCTGATGTTTTTGAGAGCGTAAAAGAGCTGACAGTCACAAGTACGTT
GATCTTTTTTGGTCTCTATTAGCCGAGCCTTATGGAATCGCATGTTAAAGTTTCGGTCACTCAGCTGTACGCTTT
CATTTATAGACCGAATCCACCGTTTCCCAACAATGATGGGTGGTCCATATATTCTCCTCGTGAAGAATTTGGGAG
GATGGGATTGGGCACAAGAATCAAGGCATGGAGATTTACGGAGGTCAACAAGGATTACGCAGTGCGTGTGTTCGG
TCTGTATGAGTGGTATGTCAACGACTAATTCAGCTCAGTTTTGCCCGACATACCCAGCAAAACTCGTTGTGCCGA
CTAGGATCAGTGACACTACCCTGCAGTATGCTTCGAAATACCGGAGTAAATGCCGAATACCAGTATTAAGTTATT
TGCACTGGGCGAATTATGTCTGTTTTGATTTTTAGATCAGTGTTTCGTTATGCTAATGAATGTGATAGGGAAGCA
TAACACGGTCAAGTCAGCCAATGGTCGGAATCACACAAAACCGGTCAATCCAGGATGAAAAGCTTATTGAGGCCA
TCTTTCAAACACACGTATCTCCCGATACACGCGTATCCAGTGGGCCAGTATATGGAGCTACTACGACCAACCTCA
TCATTGACGCACGACCTACGGCAAATGCAATGGCAAACACTGCCAAAGGTGCGGGGACGGAAAATATGGACCATT
ACAAGGACGCGAGGAAGGCCTATCTCGGGATAGATCACATTCACACAATGCGGGAGTCGCTGGCCAAAGTAGTCG
AGGCACTACGTGAGGCCGATGCTATGCTCACCAGCATCAATAGCGATTTGTCTGGTCAAGTCTCAGGAATATCTG
TGTTGGACAGGCAAGCACTACGACGATCCGGTTGGCTGCGACATATACGAGCGATCATTGAAGGCACAGTCTTGA
TATCTCGAAATATCCATGTCAATTCGTCCCACGTTCTCATACACTGTTCTGACGGCTGGGATAGAACATCCCAGT
TGTCCTCTTTGTCTCAACTATGCCTCGATCCATACTATCGTACGATCAAAGGTTTCGAAATCTTGATTGAAAAGG
ACTGGCTCTCGTTTGGCCACAAGTTTCTTGATAGGTGTGGGCACCTTTCCTCTGAAAAGTTTTTTGTTTCTCCGA
TAGAAAATCCAGGGTCTGGCAGTGGAACGGATGCTGCTCAGGCCTTTCTGGCATCGGTTCAAAATCGCTTTGCCT
CACAACAGCATATCAAGGAAACGAGCCCCGTCTTTCATCAATTTTTAGAATCTGTCCGGCAAGTCCAGAGACAAT
TCCCGACAAGGTTCGAGTTCAACGAACGCTTCCTTCGACAACTCTATTATCACCTGTATTCGTGCCAGTTTGGTA
CGTTCCTGTTCAACAACGAAAAGGAAAGAAAGACGACAAATGGACTTGAACTGCCGCTTTCTGAGAGAACGTGCA
GTGTCTGGGATTTCTTCAATTCTCCCGCTGAGATGGAGAAAAATCGGAACTCGGATTACGATCCCTCCCTTGATG
ATCCACTGAATCGTGGGTCAGGCGCTGATATGGGGGTGCTTTTCCCCAATCCCAAGGATATGCGATTTTGGAACG
AGCTGTATGGTCGTACAGACGAGGAAATGAATGGGAGAATCATAATGGCAACTTCGAAGCCTGAGGAATTATTAG
ACGTCGAGGATGATGTTAGTATTCCCCGCATGGCAACGCCTTCAAATGATCCTATGCCACCGTCACCAAATGCGG
CGCCTGCTCCCATTCCAGCATTAACGACGCAGTCGCTTGGTACTCCTTACCCTATACGTACACCCTCCCCGTCAG
CAGTCGGTAGGGTCACCTCTACAGGGTCATCAGCCACATCGTCTGGGCCGCCACCAAGTGCAGATATCTATTCCT
TGTCAGCTTCCTCTTCTTCACAGTCCCCGAGCCCGCATCAGCGGGGAAAGCCAGACTTTCTGGGTGGAGCAGGGA
TAGGAGTTAGATCAGTATGGGGAAGATTGTCTTCTAATGCCTCAACGGCTTTTTCTGCAGTCCAGGGAGCGTATG
CTGGAGTAGCTAAGGATTTGGGAAAACGAGTTGGGGGAAATGAAGATGAAGTTCCAGTAAAGACGGCGGAAATGC
ATACTCGAGAGATGCTCAGTGCATGGGGGGAAGCCCCGGCAGATCCGTTGACGTCTCAGGTCACTTCGTCTTTCT
CTGCTATGTCTGTTGGTAACAATCCATGGGCGCCGGGGCAACGGGACGTAAATACCTTGGCTTCATCACGGGATG
AGAATCCTTGGAGTGATTCTACCGTGTCACAGCAAAAATTTCCTGTCTTATCGACTGATCTATCAAGCTCGCTTC
CGCTTGATCCTACCATCCCTACACCGCTGCGTAGAATGGCAGCATCACCGACAATTCAAAAGAAAGACATAGCTC
AACCCATCAAAGACCCACCCGAGAATCCGGGAGGGACAGATCCCCTAGGCGTTGGACCACTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail