Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|053070
Gene name
Locationscaffold_03:119436..120936
Strand+
Gene length (bp)1500
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01734 Patatin Patatin-like phospholipase 3.8E-21 13 215

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 6 328 8.0E-26
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 5 328 4.0E-25
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 6 327 1.0E-24
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 10 329 7.0E-23
sp|B8AQW7|PLP1_ORYSI Patatin-like protein 1 OS=Oryza sativa subsp. indica GN=PLP1 PE=3 SV=1 3 328 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 6 328 8.0E-26
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 5 328 4.0E-25
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 6 327 1.0E-24
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 10 329 7.0E-23
sp|B8AQW7|PLP1_ORYSI Patatin-like protein 1 OS=Oryza sativa subsp. indica GN=PLP1 PE=3 SV=1 3 328 5.0E-12
sp|Q84QY3|PLP1_ORYSJ Patatin-like protein 1 OS=Oryza sativa subsp. japonica GN=PLP1 PE=3 SV=1 3 328 1.0E-11
sp|Q6ZJD3|PLP2_ORYSJ Patatin-like protein 2 OS=Oryza sativa subsp. japonica GN=PLP2 PE=3 SV=1 10 294 2.0E-11
sp|A2YW91|PLP2_ORYSI Patatin-like protein 2 OS=Oryza sativa subsp. indica GN=PLP2 PE=3 SV=1 10 294 2.0E-11
sp|O23180|PLP5_ARATH Patatin-like protein 5 OS=Arabidopsis thaliana GN=PLP5 PE=1 SV=2 7 240 2.0E-10
sp|O48723|PLP2_ARATH Patatin-like protein 2 OS=Arabidopsis thaliana GN=PLP2 PE=1 SV=1 10 218 6.0E-10
sp|Q93ZQ3|PLP9_ARATH Probable inactive patatin-like protein 9 OS=Arabidopsis thaliana GN=PLP9 PE=2 SV=1 11 248 1.0E-09
sp|O23179|PLP1_ARATH Patatin-like protein 1 OS=Arabidopsis thaliana GN=PLP1 PE=1 SV=2 7 262 1.0E-09
sp|O23181|PLP3_ARATH Patatin-like protein 3 OS=Arabidopsis thaliana GN=PLP3 PE=2 SV=2 36 352 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup243
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016000
Agaricus bisporus var bisporus H39 AgabiH39|474700
Agaricus bisporus var bisporus H39 AgabiH39|447800
Agaricus bisporus var bisporus H39 AgabiH39|447100
Agaricus bisporus var bisporus H39 AgabiH39|373300
Agaricus bisporus var bisporus H39 AgabiH39|481100
Agaricus bisporus var bisporus H39 AgabiH39|281600
Agaricus bisporus var bisporus H39 AgabiH39|278300
Agaricus bisporus var bisporus H39 AgabiH39|053070 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|371700
Agaricus bisporus var bisporus H97 AgabiH97|109720
Agaricus bisporus var bisporus H97 AgabiH97|016000
Agaricus bisporus var bisporus H97 AgabiH97|016120
Agaricus bisporus var bisporus H97 AgabiH97|020470
Agaricus bisporus var bisporus H97 AgabiH97|052840
Agaricus bisporus var bisporus H97 AgabiH97|052910
Agaricus bisporus var bisporus H97 AgabiH97|053070
Agaricus bisporus var bisporus H97 AgabiH97|054350
Agaricus bisporus var bisporus H97 AgabiH97|089750
Agaricus bisporus var bisporus H97 AgabiH97|109860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|053070
MTSSAEGPPLRLLALDGGGVRGLSELLILKEVMHQLMFEENEKRKKDGQEPLSVLPKPCDYFDLIGGTSTGGIIA
LMLGRLRMDVDTAIKNYDDLAKQVFSAMKSWGDGKFKATTLEAAMKSVVKIVTGDSESLLLESDQGEVCRTFVCA
KNAHNMDSPVLFRTYQSRETHFNCKIWEAARATSAAPTFFKRIEIGRNQPFIDGGLGRNNPSQVVLEEAKALFGA
RQIGCLVSIGTGQAEITKIKEPGLYQRIIPTGVISALKAISTDCESTHQAMLRHFAKLPNTYFRLNVDQGMQGIE
LSKWEKLSNVEAHTKQYMQKVEVAEKLVLLVSAIRVPRRQLQPEQLTMEESLMPPNELVPQARERKRCPLPVKPY
KGREEILDKMRKYFELGDDSQSVLVLHGLGGSGKTQIALKFVQESIAMFFT*
Coding >AgabiH39|053070
ATGACTTCTTCTGCAGAAGGACCGCCTTTGAGGCTGCTTGCGCTAGATGGCGGTGGGGTTCGCGGACTTTCAGAA
CTACTCATCCTCAAAGAAGTTATGCACCAGCTGATGTTTGAGGAGAACGAGAAACGGAAGAAAGACGGTCAAGAA
CCTCTTAGCGTACTCCCGAAGCCGTGCGATTACTTCGATCTGATTGGTGGTACTAGTACTGGTGGGATAATCGCT
TTGATGCTTGGGCGTCTTCGGATGGATGTAGACACGGCAATCAAAAATTACGACGATCTGGCAAAACAAGTCTTC
TCCGCTATGAAGTCATGGGGGGACGGAAAATTCAAAGCGACAACACTCGAAGCAGCCATGAAATCTGTCGTAAAG
ATCGTGACTGGTGATTCCGAGTCACTCTTATTAGAAAGCGATCAAGGTGAAGTCTGCCGAACTTTCGTATGCGCA
AAGAACGCCCACAACATGGACTCTCCAGTGCTTTTCAGGACATACCAGTCTCGTGAAACACATTTCAATTGCAAG
ATTTGGGAGGCCGCTCGAGCGACATCTGCAGCACCCACGTTTTTTAAGCGCATTGAAATCGGGCGGAACCAGCCC
TTTATCGATGGTGGACTAGGCCGCAATAATCCGAGTCAGGTGGTGCTGGAAGAAGCCAAAGCTCTATTTGGCGCT
CGTCAAATCGGGTGCTTGGTGAGCATTGGTACCGGACAGGCTGAAATAACCAAGATCAAGGAGCCTGGGTTATAT
CAGCGGATCATACCAACCGGCGTCATCAGTGCGTTGAAGGCAATCAGCACCGACTGCGAATCAACACACCAAGCA
ATGTTGCGCCATTTCGCCAAGTTGCCGAACACCTATTTTAGACTAAATGTCGACCAGGGGATGCAGGGGATAGAG
CTTTCCAAATGGGAGAAACTGAGCAACGTGGAGGCTCATACAAAGCAATATATGCAGAAGGTGGAGGTCGCTGAG
AAGCTTGTATTGCTGGTTAGTGCGATCAGAGTTCCGAGAAGGCAGCTTCAACCCGAGCAACTTACTATGGAAGAA
TCGCTCATGCCTCCAAATGAATTGGTCCCACAAGCCAGGGAACGCAAGCGTTGTCCGCTTCCTGTGAAACCATAT
AAAGGACGAGAGGAAATCCTTGATAAAATGCGCAAATATTTTGAGTTGGGGGATGACTCTCAAAGTGTCTTGGTT
TTGCATGGCCTTGGGGGCTCCGGCAAGACCCAAATTGCTCTCAAATTTGTGCAAGAATCCATCGCCATGTTCTTC
ACCTAA
Transcript >AgabiH39|053070
ATGACTTCTTCTGCAGAAGGACCGCCTTTGAGGCTGCTTGCGCTAGATGGCGGTGGGGTTCGCGGACTTTCAGAA
CTACTCATCCTCAAAGAAGTTATGCACCAGCTGATGTTTGAGGAGAACGAGAAACGGAAGAAAGACGGTCAAGAA
CCTCTTAGCGTACTCCCGAAGCCGTGCGATTACTTCGATCTGATTGGTGGTACTAGTACTGGTGGGATAATCGCT
TTGATGCTTGGGCGTCTTCGGATGGATGTAGACACGGCAATCAAAAATTACGACGATCTGGCAAAACAAGTCTTC
TCCGCTATGAAGTCATGGGGGGACGGAAAATTCAAAGCGACAACACTCGAAGCAGCCATGAAATCTGTCGTAAAG
ATCGTGACTGGTGATTCCGAGTCACTCTTATTAGAAAGCGATCAAGGTGAAGTCTGCCGAACTTTCGTATGCGCA
AAGAACGCCCACAACATGGACTCTCCAGTGCTTTTCAGGACATACCAGTCTCGTGAAACACATTTCAATTGCAAG
ATTTGGGAGGCCGCTCGAGCGACATCTGCAGCACCCACGTTTTTTAAGCGCATTGAAATCGGGCGGAACCAGCCC
TTTATCGATGGTGGACTAGGCCGCAATAATCCGAGTCAGGTGGTGCTGGAAGAAGCCAAAGCTCTATTTGGCGCT
CGTCAAATCGGGTGCTTGGTGAGCATTGGTACCGGACAGGCTGAAATAACCAAGATCAAGGAGCCTGGGTTATAT
CAGCGGATCATACCAACCGGCGTCATCAGTGCGTTGAAGGCAATCAGCACCGACTGCGAATCAACACACCAAGCA
ATGTTGCGCCATTTCGCCAAGTTGCCGAACACCTATTTTAGACTAAATGTCGACCAGGGGATGCAGGGGATAGAG
CTTTCCAAATGGGAGAAACTGAGCAACGTGGAGGCTCATACAAAGCAATATATGCAGAAGGTGGAGGTCGCTGAG
AAGCTTGTATTGCTGGTTAGTGCGATCAGAGTTCCGAGAAGGCAGCTTCAACCCGAGCAACTTACTATGGAAGAA
TCGCTCATGCCTCCAAATGAATTGGTCCCACAAGCCAGGGAACGCAAGCGTTGTCCGCTTCCTGTGAAACCATAT
AAAGGACGAGAGGAAATCCTTGATAAAATGCGCAAATATTTTGAGTTGGGGGATGACTCTCAAAGTGTCTTGGTT
TTGCATGGCCTTGGGGGCTCCGGCAAGACCCAAATTGCTCTCAAATTTGTGCAAGAATCCATCGCCATGTTCTTC
ACCTAA
Gene >AgabiH39|053070
ATGACTTCTTCTGCAGAAGGACCGCCTTTGAGGCTGCTTGCGCTAGGTATATGCGTCCGTTTGCGCTCTCTCATC
GATGGAGTCGCTAACTGGTAAACTCTGAATAGATGGCGGTGGGGTTCGCGGACTTTCAGAACTACTCATCCTCAA
AGAAGTTATGCACCAGCTGATGTTTGAGGAGAACGAGAAACGGAAGAAAGACGGTCAAGAACCTCTTAGCGTACT
CCCGAAGCCGTGCGATTACTTCGATCTGATTGGTGGTACTAGTACTGGTGGGTACGTTGTGTTACACACCCACGA
TCGTCTCATATTACTCACATGTATATTACAGGATAATCGCTTTGATGCTTGGGCGTCTTCGGATGGATGTAGACA
CGGCAATCAAAAATTACGACGATCTGGCAAAACAAGTCTTCTCCGCTATGAAGTCATGGGGGGACGGAAAATTCA
AAGCGACAACACTCGAAGCAGCCATGAAATCTGTCGTAAAGATCGTGACTGGTGATTCCGAGTCACTCTTATTAG
AAAGCGATCAAGGTGAAGTCTGCCGAACGTGAGTATATTACTTACTCTTCCGTGCATTTGGACTTTGAATTCGAA
GATTCACTAGTTTCGTATGCGCAAAGAACGCCCACAACATGGACTCTCCAGTGCTTTTCAGGACATACCAGTCTC
GTGAAACACATTTCAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCACCCACGTTTTTTAAGCGCA
TTGAAATCGGGCGGAACCAGCCCTTTATCGATGGTGGACTAGGCCGCAATAATCCGAGTCAGGTGGTGCTGGAAG
AAGCCAAAGCTCTATTTGGCGCTCGTCAAATCGGGTGCTTGGTGAGCATTGGTACCGGACAGGCTGAAATAACCA
AGATCAAGGAGCCTGGGTTATATCAGCGGATCATACCAACCGGCGTCATCAGTGCGTTGAAGGCAATCAGCACCG
ACTGCGAATCAACACACCAAGCAATGTTGCGCCATTTCGCCAAGTTGCCGAACACCTATTTTAGACTAAATGTCG
ACCAGGGGATGCAGGGGATAGAGCTTTCCAAATGGGAGAAACTGAGCAACGTGGAGGCTCATACAAAGCAATATA
TGCAGAAGGTGGAGGTCGCTGAGAAGCTTGTATTGCTGGTTAGTGCGATCAGAGTTCCGAGAAGGCAGCTTCAAC
CCGAGCAACTTACTATGGAAGAATCGCTCATGTAGATCTCCATAATAATCTAATCTCGTTACCCTAGTTAATCCT
AGGCCTCCAAATGAATTGGTCCCACAAGCCAGGGAACGCAAGCGTTGTCCGCTTCCTGTGAAACCATATAAAGGA
CGAGAGGAAATCCTTGATAAAATGCGCAAATATTTTGAGTTGGGGGATGACTCTCAAAGTGTCTTGGTTTTGCAT
GGCCTTGGGGGCTCCGGCAAGACCCAAATTGCTCTCAAATTTGTGCAAGAATCCATCGCCATGTTCTTCACCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail