Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|051900
Gene name
Locationscaffold_02:3075752..3076444
Strand-
Gene length (bp)692
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P83811|CAP_COPCM Antiviral protein CAP (Fragment) OS=Coprinus comatus PE=1 SV=1 54 144 2.0E-13

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 34 0.999196

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup9593
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|051900 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|274400
Agaricus bisporus var bisporus H97 AgabiH97|051900
Agaricus bisporus var bisporus H97 AgabiH97|051910

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|051900
MLKGSQEPLVQLNYLTMYFKAYLVASTLIAVAAAQDSLTCFQGPPTAAAPATDCTPFVDDFCDSVGLLRVRVNDS
ITRCYELPNENVCDFGVHNTMVLDNPPSIVNCKTILTSAISQCNLGGFGKIAPVAYTFTVDVNRAQCGTLHVGN*
Coding >AgabiH39|051900
ATGCTCAAGGGATCGCAAGAACCTCTCGTGCAACTCAACTACCTCACAATGTATTTCAAAGCCTACCTCGTCGCG
TCGACTCTCATCGCCGTTGCAGCGGCTCAAGATAGTCTTACCTGTTTCCAAGGTCCACCTACTGCTGCGGCTCCT
GCCACTGACTGTACCCCATTTGTGGACGACTTTTGCGACTCGGTTGGCTTGCTCAGAGTACGTGTCAATGATTCG
ATAACTCGCTGCTACGAGTTACCGAATGAAAACGTTTGCGACTTTGGGGTACATAATACAATGGTGTTGGATAAC
CCACCTTCTATAGTCAATTGCAAAACTATACTGACCAGTGCTATCTCTCAATGCAACTTGGGTGGTTTTGGAAAG
ATTGCTCCCGTTGCCTATACCTTCACGGTTGATGTTAACCGCGCACAATGCGGCACTCTACATGTCGGGAATTAA
Transcript >AgabiH39|051900
ATGCTCAAGGGATCGCAAGAACCTCTCGTGCAACTCAACTACCTCACAATGTATTTCAAAGCCTACCTCGTCGCG
TCGACTCTCATCGCCGTTGCAGCGGCTCAAGATAGTCTTACCTGTTTCCAAGGTCCACCTACTGCTGCGGCTCCT
GCCACTGACTGTACCCCATTTGTGGACGACTTTTGCGACTCGGTTGGCTTGCTCAGAGTACGTGTCAATGATTCG
ATAACTCGCTGCTACGAGTTACCGAATGAAAACGTTTGCGACTTTGGGGTACATAATACAATGGTGTTGGATAAC
CCACCTTCTATAGTCAATTGCAAAACTATACTGACCAGTGCTATCTCTCAATGCAACTTGGGTGGTTTTGGAAAG
ATTGCTCCCGTTGCCTATACCTTCACGGTTGATGTTAACCGCGCACAATGCGGCACTCTACATGTCGGGAATTAA
Gene >AgabiH39|051900
ATGCTCAAGGGATCGCAAGAACCTCTCGTGCAACTCAACTACCTCACAATGTATTTCAAAGCCGTACGTCCACGA
TATGGTGATGGTGGAATTTCGACCAACTGACTGGGTACATTTGTAGTACCTCGTCGCGTCGACTCTCATCGCCGT
TGCAGCGGCTCAAGATAGTCTTACCTGTTTCCAAGGTCCACCTACTGCTGCGGCTCCTGCCACTGACTGTACCCC
ATTTGTGGACGACTTTTGCGACTCGGTTGGCTTGCTCAGAGTAAGTACTACTAAGTCGGTAGTGTCCCTCGAAAC
TGACCAGCGAGATTACGCATGTTCCCAAAGGTACGTGTCAATGATTCGATAACTCGCTGCTACGAGTTACCGAAT
GAAAACGTTTGTGAGTAGTGTTCTTAGGTTCTACCCTTAGTATCGGTGACTCATGGCGTATATCATGATAGGCGA
CTTTGGGGTACATAATACAATGGTGTTGGATAACCCACCTTCTATAGTCAATTGCAAAACTATACTGACCAGTGC
TATCTCTCAATGCAACTTGGTAAACTTCGTGTATATTCGAATTATCATACTGAATACTTACTGACGACGAAATCT
AGGGTGGTTTTGGAAAGATTGCTCCCGTTGCCTATACCTTCACGGTTGATGTTAACCGCGCACAATGCGGCACTC
TACATGTCGGGAATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail