Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|051590
Gene name
Locationscaffold_02:3006243..3008660
Strand+
Gene length (bp)2417
Transcript length (bp)1860
Coding sequence length (bp)1860
Protein length (aa) 620

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.7E-30 62 394

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 82 578 5.0E-12
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 82 371 8.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 277 299 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup44
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|020370
Agaricus bisporus var bisporus H39 AgabiH39|022990
Agaricus bisporus var bisporus H39 AgabiH39|051590 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|109980
Agaricus bisporus var bisporus H39 AgabiH39|271800
Agaricus bisporus var bisporus H97 AgabiH97|020370
Agaricus bisporus var bisporus H97 AgabiH97|022990
Agaricus bisporus var bisporus H97 AgabiH97|051370
Agaricus bisporus var bisporus H97 AgabiH97|051590
Agaricus bisporus var bisporus H97 AgabiH97|109980
Rhodonia placenta FPRL280 RhoplFPRL280|583_3
Rhodonia placenta FPRL280 RhoplFPRL280|465_2
Rhodonia placenta FPRL280 RhoplFPRL280|465_1
Rhodonia placenta FPRL280 RhoplFPRL280|210_1
Rhodonia placenta FPRL280 RhoplFPRL280|103_1
Rhodonia placenta FPRL280 RhoplFPRL280|150_1
Rhodonia placenta FPRL280 RhoplFPRL280|117_1
Rhodonia placenta FPRL280 RhoplFPRL280|103_4
Rhodonia placenta FPRL280 RhoplFPRL280|86_1
Rhodonia placenta FPRL280 RhoplFPRL280|168_2
Rhodonia placenta FPRL280 RhoplFPRL280|93_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|051590
MRTEVANQQYSGIKMVKRSLKAPPTLSVYSQRPYFHWLREMRLPPLEECPSISEALDFRREHNPQEPLYVFSVDS
ATAEPTSVSFEQFGRACDRVAQFVRPGRIGNESDGTVVALLLVTDVLLYQAMLIGIMKSGYVPFPMSQRLTPQAI
IHLLTKSSCHHLMVTSAMLPTDLLDRIKQELEIHHPNYELHVSEMPSPSDIYPEHWGITSSSISYPVPSQRSSPD
SVALYFHSSGSTGLPKVVPHTNRVTCSWAALTLPQFEDFQVPSHRRYATMALLPAHVLAYLGNTIFGIYYGFTMG
LYPPTGSSLSASPMVSTPDNFLEHAKRTRCSGIIAPPIFMKAWARSESDIKELAKFRHIIFAGGPLSTEVGDALV
AAGVNLQSMYGASEFGIPTKLLPQRGREKDWEWIEFCDSDSHNFIDQNDGTYEYHFMPNGLHQPSVINRPDGKGY
ASSDLFIKHPTNNKLWKIIGRLDDMVILSNGVNIVSGPIEAIMLNSPSIDGAVVFGRGYDRAGILIEPSSYEQFE
SPETAHEFRDLIWALVERANSAAPLYYRILNEMILFTSQDKPLPRTLKGTVMRKLALKLYEEEIDRIYRDISLSD
NNYRTALECWEAPGLENGP*
Coding >AgabiH39|051590
ATGCGAACAGAAGTCGCTAACCAGCAATATAGTGGCATCAAGATGGTTAAAAGAAGTTTAAAAGCACCCCCAACT
CTGTCAGTCTACTCTCAACGGCCATATTTCCACTGGCTTAGAGAAATGCGTCTCCCTCCACTTGAAGAGTGCCCT
AGTATTTCTGAGGCCCTGGACTTCCGCCGAGAACACAATCCTCAGGAGCCACTTTATGTTTTTAGCGTCGATTCA
GCGACCGCAGAACCCACAAGCGTGTCGTTCGAACAATTTGGTCGTGCCTGCGACCGCGTGGCGCAATTCGTCCGA
CCTGGACGCATCGGGAACGAGTCCGACGGTACTGTCGTCGCACTCCTGCTTGTCACCGATGTCCTCCTTTATCAA
GCCATGTTAATTGGAATCATGAAGTCTGGCTATGTGCCATTTCCCATGTCACAGCGCCTCACGCCTCAAGCTATC
ATTCATTTACTGACGAAATCGTCGTGCCATCATCTAATGGTAACTTCCGCGATGCTTCCTACAGATTTGTTAGAC
AGAATTAAGCAAGAACTCGAGATTCATCATCCGAATTACGAGTTACACGTCTCGGAAATGCCCTCCCCATCTGAT
ATCTACCCAGAGCACTGGGGAATAACATCAAGCAGCATATCTTATCCTGTTCCATCGCAACGTTCATCTCCTGAT
AGCGTCGCTCTCTATTTCCATTCTTCTGGAAGTACAGGTTTACCAAAGGTTGTTCCACACACAAATCGAGTTACT
TGTAGTTGGGCTGCACTGACTCTTCCACAATTCGAAGACTTTCAGGTTCCTTCGCATCGCCGATACGCTACGATG
GCTCTCCTGCCAGCGCATGTTCTCGCGTACCTCGGAAATACTATATTCGGCATTTACTATGGCTTTACCATGGGT
CTCTATCCACCAACTGGATCGTCTTTGAGCGCTTCACCCATGGTCTCCACCCCCGACAATTTCCTCGAACATGCA
AAAAGAACTCGGTGCAGCGGCATAATTGCCCCTCCAATATTCATGAAAGCTTGGGCACGGTCAGAGTCGGATATT
AAAGAATTGGCAAAGTTCAGACATATTATTTTCGCTGGAGGCCCATTATCTACGGAAGTTGGGGACGCTCTCGTT
GCAGCCGGAGTGAATTTACAGTCCATGTATGGAGCATCAGAATTTGGGATTCCTACGAAACTATTACCTCAACGA
GGTAGAGAGAAAGACTGGGAATGGATTGAATTCTGCGATTCAGATTCTCACAACTTCATCGATCAGAACGATGGT
ACATATGAGTATCATTTCATGCCAAATGGACTTCACCAACCATCTGTTATCAATCGGCCGGACGGCAAGGGCTAT
GCAAGTTCGGACCTTTTTATCAAGCACCCTACAAACAACAAGCTTTGGAAAATTATTGGTCGGCTAGACGACATG
GTGATACTTTCTAATGGTGTAAACATTGTCTCAGGACCTATTGAAGCCATCATGCTCAATAGTCCATCAATCGAC
GGTGCTGTTGTCTTCGGACGAGGTTATGACAGGGCTGGGATCCTGATCGAACCAAGCTCATACGAACAGTTTGAA
TCTCCCGAGACTGCGCATGAATTCCGTGATTTGATCTGGGCACTGGTCGAGAGAGCGAATAGCGCTGCACCGCTG
TATTACCGCATATTGAATGAGATGATCCTTTTTACCAGTCAAGATAAACCTTTGCCTCGTACTCTCAAAGGAACC
GTTATGAGGAAGTTGGCACTAAAATTGTATGAAGAGGAGATTGACAGAATATACAGAGATATTTCTCTTTCTGAC
AACAACTATAGAACAGCACTCGAGTGTTGGGAAGCGCCAGGGCTGGAAAATGGGCCCTAG
Transcript >AgabiH39|051590
ATGCGAACAGAAGTCGCTAACCAGCAATATAGTGGCATCAAGATGGTTAAAAGAAGTTTAAAAGCACCCCCAACT
CTGTCAGTCTACTCTCAACGGCCATATTTCCACTGGCTTAGAGAAATGCGTCTCCCTCCACTTGAAGAGTGCCCT
AGTATTTCTGAGGCCCTGGACTTCCGCCGAGAACACAATCCTCAGGAGCCACTTTATGTTTTTAGCGTCGATTCA
GCGACCGCAGAACCCACAAGCGTGTCGTTCGAACAATTTGGTCGTGCCTGCGACCGCGTGGCGCAATTCGTCCGA
CCTGGACGCATCGGGAACGAGTCCGACGGTACTGTCGTCGCACTCCTGCTTGTCACCGATGTCCTCCTTTATCAA
GCCATGTTAATTGGAATCATGAAGTCTGGCTATGTGCCATTTCCCATGTCACAGCGCCTCACGCCTCAAGCTATC
ATTCATTTACTGACGAAATCGTCGTGCCATCATCTAATGGTAACTTCCGCGATGCTTCCTACAGATTTGTTAGAC
AGAATTAAGCAAGAACTCGAGATTCATCATCCGAATTACGAGTTACACGTCTCGGAAATGCCCTCCCCATCTGAT
ATCTACCCAGAGCACTGGGGAATAACATCAAGCAGCATATCTTATCCTGTTCCATCGCAACGTTCATCTCCTGAT
AGCGTCGCTCTCTATTTCCATTCTTCTGGAAGTACAGGTTTACCAAAGGTTGTTCCACACACAAATCGAGTTACT
TGTAGTTGGGCTGCACTGACTCTTCCACAATTCGAAGACTTTCAGGTTCCTTCGCATCGCCGATACGCTACGATG
GCTCTCCTGCCAGCGCATGTTCTCGCGTACCTCGGAAATACTATATTCGGCATTTACTATGGCTTTACCATGGGT
CTCTATCCACCAACTGGATCGTCTTTGAGCGCTTCACCCATGGTCTCCACCCCCGACAATTTCCTCGAACATGCA
AAAAGAACTCGGTGCAGCGGCATAATTGCCCCTCCAATATTCATGAAAGCTTGGGCACGGTCAGAGTCGGATATT
AAAGAATTGGCAAAGTTCAGACATATTATTTTCGCTGGAGGCCCATTATCTACGGAAGTTGGGGACGCTCTCGTT
GCAGCCGGAGTGAATTTACAGTCCATGTATGGAGCATCAGAATTTGGGATTCCTACGAAACTATTACCTCAACGA
GGTAGAGAGAAAGACTGGGAATGGATTGAATTCTGCGATTCAGATTCTCACAACTTCATCGATCAGAACGATGGT
ACATATGAGTATCATTTCATGCCAAATGGACTTCACCAACCATCTGTTATCAATCGGCCGGACGGCAAGGGCTAT
GCAAGTTCGGACCTTTTTATCAAGCACCCTACAAACAACAAGCTTTGGAAAATTATTGGTCGGCTAGACGACATG
GTGATACTTTCTAATGGTGTAAACATTGTCTCAGGACCTATTGAAGCCATCATGCTCAATAGTCCATCAATCGAC
GGTGCTGTTGTCTTCGGACGAGGTTATGACAGGGCTGGGATCCTGATCGAACCAAGCTCATACGAACAGTTTGAA
TCTCCCGAGACTGCGCATGAATTCCGTGATTTGATCTGGGCACTGGTCGAGAGAGCGAATAGCGCTGCACCGCTG
TATTACCGCATATTGAATGAGATGATCCTTTTTACCAGTCAAGATAAACCTTTGCCTCGTACTCTCAAAGGAACC
GTTATGAGGAAGTTGGCACTAAAATTGTATGAAGAGGAGATTGACAGAATATACAGAGATATTTCTCTTTCTGAC
AACAACTATAGAACAGCACTCGAGTGTTGGGAAGCGCCAGGGCTGGAAAATGGGCCCTAG
Gene >AgabiH39|051590
ATGCGAACAGAAGTCGCTAACCAGCAGTTAGCATTTCTGCGCCACAAATATTGTGAGAGCAGAAGCTTGTCGGTA
CAGATATAGTGTAATCACCTCCCTCGTATCTCTCCGCTACGATTTAGTTTAACGCTATTTTGTAGGGCATCAAGA
TGGTTAAAAGAAGTTTAAAAGCACCCCCAACTCTGTCAGTCTACTCTCAACGGCCATATTTCCACTGGCTTAGAG
AAATGCGTCTCCCTCCACTTGAAGAGTGCCCTAGTATTTCTGAGGCCCTGGACTTCCGCCGAGAACACAATCCTC
AGGAGCCACTTTATGTTTTTAGCGTCGATTCAGCGACCGCAGAACCCACAAGCGTGTCGTTCGAACAATTTGGTC
GTGCCTGCGACCGCGTGGCGCAATTCGTCCGACCTGGACGCATCGGGAACGAGTCCGACGGTACTGTCGTCGCAC
TCCTGCTTGTCACCGATGTCCTCCTTTATCAAGCCATGTTAATTGGAATCATGAAGTCTGGCTATGTGGTAAGAG
TATTGTGTATAGTACCAACCTCGTCGCATGCTCTTAATGTTCTCCCTAGCCATTTCCCATGTCACAGCGCCTCAC
GCCTCAAGCTATCATTCATTTACTGACGAAATCGTCGTGCCATCATCTAATGGTAACTTCCGCGATGCTTCCTAC
AGATTTGTTAGACAGAATTAAGCAAGAACTCGAGATTCATCATCCGAATTACGAGTTACACGTCTCGGAAATGCC
CTCCCCATCTGATATCTACCCAGAGCACTGGGGAATAACATCAAGCAGCATATCTTATCCTGTTCCATCGCAACG
TTCATCTCCTGATAGCGTCGCTCTCTATTTCCATTCTTCTGGAAGTACAGGTTTACCAAAGGTTGTTCCACACAC
AAATCGAGTTACTTGTAGTTGGGCTGCACTGAGTAAGCCTGTTACTAGCTAGATCTTCCATCCCTCAACGTCCAA
TAACACCTTGTGTAGCTCTTCCACAATTCGAAGACTTTCAGGTTCCTTCGCATCGCCGATACGCTACGATGGCTC
TCCTGCCAGCGCATGTTCTCGCGTACCTCGGAAATACTATATTCGGCATTTACTATGGCTTTACCATGGGTCTCT
ATCCACCAACTGGATCGTCTTTGAGCGCTTCACCCATGGTCTCCACCCCCGACAATTTCCTCGAACATGCAAAAA
GAACTCGGTGCAGCGGCATAATTGCCCCTCCAATATTCATGAAAGCTTGGGCACGGTCAGAGTCGGATATTAAAG
AATTGGCAAAGTTCAGACATATTGTATGTTTGTTGACGCTCCTCTTGCTGGAATTCATCGGATAACATGACTTAG
ATTTTCGCTGGAGGCCCATTATCTACGGAAGTTGGGGACGCTCTCGTTGCAGCCGGAGTGAATTTACAGTCCATG
TATGGAGCATCAGAATTTGGGATTCCTACGAAACTATTACCTCAACGAGGTAGAGAGAAAGACTGGGAATGGATT
GAATTCTGCGATTCAGATTCTCACAACTTCATCGATCAGAACGATGGTACATATGAGTATCATTTCATGGTAAGC
CCATCCGATTCTATCAACTAGCATTTTGGGTTTTAGCTCATGACACACACGTTAGCCAAATGGACTTCACCAACC
ATCTGTTATCAATCGGCCGGACGGCAAGGGCTATGCAAGTTCGGACCTTTTTATCAAGCACCCTACAAACAACAA
GCTTTGGAAAATGTGTTGGCAATTTATTTGCTATAGAAACACCATTTTACTAACTAATTTGTATCAAGTATTGGT
CGGCTAGACGACATGGTGATACTTTCTAATGGTGTAAACATTGTCTCAGGACCTATTGAAGCCATCATGCTCAAT
AGTCCATCGTGAGTACATACTTCTCAACATGATGCGCTCCTAACTCAAATTATAATGGCGTCAAGAATCGACGGT
GCTGTTGTCTTCGGACGAGGTTATGACAGGGCTGGGATCCTGATCGAACCAAGCTCATACGAACAGTTTGAATCT
CCCGAGACTGCGCATGAATTCCGTGATTTGATCTGGTAAGTGACGCAGTTATCACCATTCAAAATGTTTCTTTTA
GCATTTTCGATTAGGGCACTGGTCGAGAGAGCGAATAGCGCTGCACCGCTGTATTACCGCATATTGAATGAGATG
ATCCTTTTTACCAGTCAAGATAAACCTTTGCCTCGTACTCTCAAAGGAACCGTTATGAGGAAGTTGGCACTAAAA
TTGTATGAAGAGGAGATTGACAGAATGTACGTTTCTCTTATTTGGAATTCAGTGTTCGGGAACCAACCTCTGAAC
TCAATAGATACAGAGATATTTCTCTTTCTGACAACAACTATAGAACAGCACTCGAGTGTTGGGAAGCGCCAGGGC
TGGAAAATGGGCCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail