Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|047690
Gene name
Locationscaffold_02:2202039..2204192
Strand+
Gene length (bp)2153
Transcript length (bp)1833
Coding sequence length (bp)1833
Protein length (aa) 611

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.3E-02 397 414
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 9.4E-05 475 492
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.6E-02 504 521

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 397 494 3.0E-15
sp|P32505|NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAB2 PE=1 SV=1 396 547 1.0E-13
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 12 87 2.0E-08
sp|Q3ZC82|ZC3HE_BOVIN Zinc finger CCCH domain-containing protein 14 OS=Bos taurus GN=ZC3H14 PE=2 SV=2 380 537 1.0E-07
sp|Q5TYQ8|ZC3HE_DANRE Zinc finger CCCH domain-containing protein 14 OS=Danio rerio GN=zc3h14 PE=2 SV=1 390 521 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 397 494 3.0E-15
sp|P32505|NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAB2 PE=1 SV=1 396 547 1.0E-13
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 12 87 2.0E-08
sp|Q3ZC82|ZC3HE_BOVIN Zinc finger CCCH domain-containing protein 14 OS=Bos taurus GN=ZC3H14 PE=2 SV=2 380 537 1.0E-07
sp|Q5TYQ8|ZC3HE_DANRE Zinc finger CCCH domain-containing protein 14 OS=Danio rerio GN=zc3h14 PE=2 SV=1 390 521 3.0E-07
sp|Q08AZ1|ZC3HE_XENLA Zinc finger CCCH domain-containing protein 14 OS=Xenopus laevis GN=zc3h14 PE=2 SV=2 398 521 1.0E-06
sp|Q8BJ05|ZC3HE_MOUSE Zinc finger CCCH domain-containing protein 14 OS=Mus musculus GN=Zc3h14 PE=1 SV=1 380 538 2.0E-06
sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 14 OS=Rattus norvegicus GN=Zc3h14 PE=1 SV=1 380 536 3.0E-06
sp|Q5F3Z9|ZC3HE_CHICK Zinc finger CCCH domain-containing protein 14 OS=Gallus gallus GN=ZC3H14 PE=2 SV=1 398 521 7.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup3822
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|047690 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|047690
Rhodonia placenta FPRL280 RhoplFPRL280|17_34

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|047690
MPFGLTMGTERANALQQSIQDELTKRGYSQDADPVMAEYITIMVINNKTAGQITTELEDLIGSEYDPTFTDWLFV
EAAKGTSVPETSPQSQPLPPPSPPNDLPTREPPTHPPRDSSTRTSHPPRSGIYQQAVSQATSSVSSQKRSASARS
PSPGLPNKSRKTDLPTGPRAMQREGGPANSRSLLDRMSGHAASNRHQRDEIQARIDNITNNSPEANMMMSGGGFP
GMPMAGMDMNAVAMANPLMLQEMFMNNMALMQHLSSQIGVMQGFTNAPPGYNISGNGVINEAGAFHGGPNNFGQT
HRGRGSGRGRGGGRGRGGSHVGASSSPKVTEAAMLTEVPATPFNVSSQSPVNVPATATIASPAPTPVAAVPTATS
GQTSSVSQIPYAVPERPQSPTLCKFGLKCTNVHCRWSHPSPVATPESGVVLSNEACENGKNCKDKDCIKAHVSPA
TLNPPAQPPIPAPAAVAHTPSNSTPCRFGLACTRPNCMFSHPSRPASNSQYATPCRFGAACTRAACPYQHPEGRV
LPTTFHRGLAPNGPMAHIPNSETGSMGSSPHRSMTFNNPKAKLEKQVKDLEERKNDAEKAIKEAQVAAASSSNGK
EELKPVATAA*
Coding >AgabiH39|047690
ATGCCTTTCGGTCTTACTATGGGTACGGAGCGGGCAAATGCCCTACAGCAATCCATCCAGGATGAACTTACGAAG
CGAGGTTATAGTCAGGATGCTGACCCTGTAATGGCGGAGTATATCACTATCATGGTGATCAACAACAAGACTGCT
GGTCAAATCACTACAGAATTAGAAGATTTGATTGGCTCAGAGTATGACCCTACATTCACAGATTGGTTGTTTGTA
GAAGCAGCAAAAGGTACCAGTGTGCCTGAAACTTCGCCGCAGTCTCAACCCTTGCCACCTCCCTCTCCCCCAAAT
GACCTGCCTACGCGCGAGCCTCCCACTCACCCGCCTCGAGACAGTTCGACTCGTACTTCCCACCCGCCACGTAGC
GGTATCTACCAACAGGCGGTTTCTCAAGCCACTTCATCTGTCTCATCTCAAAAGCGTTCTGCATCTGCGCGTTCA
CCATCACCCGGCCTTCCAAATAAGTCCCGAAAAACTGACTTGCCTACGGGGCCGCGAGCAATGCAACGTGAAGGT
GGACCAGCGAATAGTCGGAGTCTGCTAGATCGTATGAGTGGTCATGCTGCATCCAATAGGCATCAACGCGACGAG
ATCCAAGCCCGTATTGACAACATTACGAATAATTCCCCAGAAGCCAATATGATGATGAGTGGTGGTGGATTCCCG
GGCATGCCTATGGCGGGGATGGACATGAACGCTGTGGCAATGGCTAATCCCCTTATGCTTCAAGAAATGTTCATG
AACAATATGGCTCTCATGCAACACCTATCATCGCAAATTGGAGTGATGCAGGGCTTCACGAATGCGCCACCCGGG
TACAATATCTCAGGAAATGGTGTCATAAACGAGGCGGGGGCGTTTCATGGAGGTCCCAATAATTTTGGACAAACA
CACAGAGGCAGGGGTAGCGGGAGAGGTAGAGGAGGTGGTAGGGGGCGTGGTGGTTCTCATGTGGGCGCATCATCT
TCTCCTAAGGTGACTGAAGCCGCAATGTTGACTGAAGTTCCTGCAACGCCATTCAATGTCTCTTCCCAATCCCCT
GTTAATGTTCCTGCGACTGCCACTATTGCATCCCCTGCACCTACCCCCGTTGCTGCTGTTCCTACCGCCACCTCA
GGACAAACATCGTCTGTTTCGCAAATACCTTACGCAGTACCCGAGCGGCCTCAGTCCCCAACGCTCTGTAAATTT
GGTCTAAAATGCACTAATGTGCATTGTCGGTGGTCACACCCTTCACCTGTCGCGACCCCAGAAAGTGGTGTCGTG
CTCAGCAACGAAGCTTGTGAAAACGGCAAGAACTGCAAAGACAAGGACTGTATAAAGGCCCACGTGAGCCCCGCA
ACTCTTAACCCTCCTGCTCAACCCCCAATTCCAGCTCCCGCTGCTGTAGCTCACACGCCTTCTAATTCTACCCCC
TGCCGCTTTGGCCTTGCGTGCACTCGACCGAATTGCATGTTTAGCCACCCTTCTAGGCCAGCTTCTAACTCGCAA
TACGCTACACCTTGTCGTTTCGGTGCCGCTTGTACTCGTGCAGCCTGCCCCTACCAGCATCCAGAAGGTCGTGTG
CTACCCACTACCTTCCACCGTGGACTAGCGCCAAATGGCCCTATGGCGCATATACCAAATTCTGAAACGGGTTCA
ATGGGCTCTAGTCCTCACAGAAGCATGACTTTCAATAATCCAAAAGCGAAATTGGAGAAACAAGTGAAGGATCTG
GAAGAGAGAAAAAATGATGCTGAGAAAGCCATCAAGGAGGCGCAAGTAGCTGCAGCTTCAAGTTCTAATGGGAAG
GAGGAACTTAAACCAGTTGCGACTGCAGCTTAA
Transcript >AgabiH39|047690
ATGCCTTTCGGTCTTACTATGGGTACGGAGCGGGCAAATGCCCTACAGCAATCCATCCAGGATGAACTTACGAAG
CGAGGTTATAGTCAGGATGCTGACCCTGTAATGGCGGAGTATATCACTATCATGGTGATCAACAACAAGACTGCT
GGTCAAATCACTACAGAATTAGAAGATTTGATTGGCTCAGAGTATGACCCTACATTCACAGATTGGTTGTTTGTA
GAAGCAGCAAAAGGTACCAGTGTGCCTGAAACTTCGCCGCAGTCTCAACCCTTGCCACCTCCCTCTCCCCCAAAT
GACCTGCCTACGCGCGAGCCTCCCACTCACCCGCCTCGAGACAGTTCGACTCGTACTTCCCACCCGCCACGTAGC
GGTATCTACCAACAGGCGGTTTCTCAAGCCACTTCATCTGTCTCATCTCAAAAGCGTTCTGCATCTGCGCGTTCA
CCATCACCCGGCCTTCCAAATAAGTCCCGAAAAACTGACTTGCCTACGGGGCCGCGAGCAATGCAACGTGAAGGT
GGACCAGCGAATAGTCGGAGTCTGCTAGATCGTATGAGTGGTCATGCTGCATCCAATAGGCATCAACGCGACGAG
ATCCAAGCCCGTATTGACAACATTACGAATAATTCCCCAGAAGCCAATATGATGATGAGTGGTGGTGGATTCCCG
GGCATGCCTATGGCGGGGATGGACATGAACGCTGTGGCAATGGCTAATCCCCTTATGCTTCAAGAAATGTTCATG
AACAATATGGCTCTCATGCAACACCTATCATCGCAAATTGGAGTGATGCAGGGCTTCACGAATGCGCCACCCGGG
TACAATATCTCAGGAAATGGTGTCATAAACGAGGCGGGGGCGTTTCATGGAGGTCCCAATAATTTTGGACAAACA
CACAGAGGCAGGGGTAGCGGGAGAGGTAGAGGAGGTGGTAGGGGGCGTGGTGGTTCTCATGTGGGCGCATCATCT
TCTCCTAAGGTGACTGAAGCCGCAATGTTGACTGAAGTTCCTGCAACGCCATTCAATGTCTCTTCCCAATCCCCT
GTTAATGTTCCTGCGACTGCCACTATTGCATCCCCTGCACCTACCCCCGTTGCTGCTGTTCCTACCGCCACCTCA
GGACAAACATCGTCTGTTTCGCAAATACCTTACGCAGTACCCGAGCGGCCTCAGTCCCCAACGCTCTGTAAATTT
GGTCTAAAATGCACTAATGTGCATTGTCGGTGGTCACACCCTTCACCTGTCGCGACCCCAGAAAGTGGTGTCGTG
CTCAGCAACGAAGCTTGTGAAAACGGCAAGAACTGCAAAGACAAGGACTGTATAAAGGCCCACGTGAGCCCCGCA
ACTCTTAACCCTCCTGCTCAACCCCCAATTCCAGCTCCCGCTGCTGTAGCTCACACGCCTTCTAATTCTACCCCC
TGCCGCTTTGGCCTTGCGTGCACTCGACCGAATTGCATGTTTAGCCACCCTTCTAGGCCAGCTTCTAACTCGCAA
TACGCTACACCTTGTCGTTTCGGTGCCGCTTGTACTCGTGCAGCCTGCCCCTACCAGCATCCAGAAGGTCGTGTG
CTACCCACTACCTTCCACCGTGGACTAGCGCCAAATGGCCCTATGGCGCATATACCAAATTCTGAAACGGGTTCA
ATGGGCTCTAGTCCTCACAGAAGCATGACTTTCAATAATCCAAAAGCGAAATTGGAGAAACAAGTGAAGGATCTG
GAAGAGAGAAAAAATGATGCTGAGAAAGCCATCAAGGAGGCGCAAGTAGCTGCAGCTTCAAGTTCTAATGGGAAG
GAGGAACTTAAACCAGTTGCGACTGCAGCTTAA
Gene >AgabiH39|047690
ATGCCTTTCGGTCTTACTATGGGTACGGAGCGGGCAAATGCCCTACAGGTAAGCTATGCGTCGCACAATTTAAGC
TAGATTTTTTGTGAATTTATCTGCCCTTTTACAGCAATCCATCCAGGATGAACTTACGAAGCGAGGTTATAGTCA
GGATGCTGGTGAGTCGGCCTACGACATAAGGCGTGCATCAGAACCTGAACAACGTTTTAGACCCTGTAATGGCGG
AGTATATCACTATCATGGTGATCAACAACAAGACTGCTGGTACGTGTTGGTGTTCATTTTCCCCCTCGCCGACTC
ACACTTTGTTCAGGTCAAATCACTACAGAATTAGAAGATTGTATGTGTTTTTCTATCTCTTTTTTGTTTTTGATA
TCATTGACGCATCATTCACTCTAGTGATTGGCTCAGAGTATGGTAAAGACCAATAACTTATTTCTCCCGACTCTT
GCTAACTTTTACCTAGACCCTACATTCACAGATTGGTTGTTTGTAGAAGCAGCAAAAGGTACCAGTGTGCCTGAA
ACTTCGCCGCAGTCTCAACCCTTGCCACCTCCCTCTCCCCCAAATGACCTGCCTACGCGCGAGCCTCCCACTCAC
CCGCCTCGAGACAGTTCGACTCGTACTTCCCACCCGCCACGTAGCGGTATCTACCAACAGGCGGTTTCTCAAGCC
ACTTCATCTGTCTCATCTCAAAAGCGTTCTGCATCTGCGCGTTCACCATCACCCGGCCTTCCAAATAAGTCCCGA
AAAACTGACTTGCCTACGGGGCCGCGAGCAATGCAACGTGAAGGTGGACCAGCGAATAGTCGGAGTCTGCTAGAT
CGTATGAGTGGTCATGCTGCATCCAATAGGCATCAACGCGACGAGATCCAAGCCCGTATTGACAACATTACGAAT
AATTCCCCAGAAGCCAATATGATGATGAGTGGTGGTGGATTCCCGGGCATGCCTATGGCGGGGATGGACATGAAC
GCTGTGGCAATGGCTAATCCCCTTATGCTTCAAGAAATGTTCATGAACAATATGGCTCTCATGCAACACCTATCA
TCGCAAATTGGAGTGATGCAGGGCTTCACGAATGCGCCACCCGGGTACAATATCTCAGGAAATGGTGTCATAAAC
GAGGCGGGGGCGTTTCATGGAGGTCCCAATAATTTTGGACAAACACACAGAGGCAGGGGTAGCGGGAGAGGTAGA
GGAGGTGGTAGGGGGCGTGGTGGTTCTCATGTGGGCGCATCATCTTCTCCTAAGGTGACTGAAGCCGCAATGTTG
ACTGAAGTTCCTGCAACGCCATTCAATGTCTCTTCCCAATCCCCTGTTAATGTTCCTGCGACTGCCACTATTGCA
TCCCCTGCACCTACCCCCGTTGCTGCTGTTCCTACCGCCACCTCAGGACAAACATCGTCTGTTTCGCAAATACCT
TACGCAGTACCCGAGCGGCCTCAGTCCCCAACGCTCTGTAAATTTGGTCTAAAATGCACTAATGTGCATTGTCGG
TGGTCACACCCTTCACCTGTCGCGACCCCAGAAAGTGGTGTCGTGCTCAGCAACGAAGCTTGTGAAAACGGCAAG
AACTGCAAAGACAAGGACTGTATAAAGGCCCACGTGAGCCCCGCAACTCTTAACCCTCCTGGTATGTTTCTCCAC
TATAGTCGAAGAGCTTTTGATGAGACTGTTTTCTAGCTCAACCCCCAATTCCAGCTCCCGCTGCTGTAGCTCACA
CGCCTTCTAATTCTACCCCCTGCCGCTTTGGCCTTGCGTGCACTCGACCGAATTGCATGTTTAGCCACCCTTCTA
GGCCAGCTTCTAACTCGCAATACGCTACACCTTGTCGTTTCGGTGCCGCTTGTACTCGTGCAGCCTGCCCCTACC
AGCATCCAGAAGGTCGTGTGCTACCCACTACCTTCCACCGTGGACTAGCGCCAAATGGCCCTATGGCGCATATAC
CAAATTCTGAAACGGGTTCAATGGGCTCTAGTCCTCACAGAAGCATGACTTTCAATAATCCAAAAGCGAAATTGG
AGAAACAAGTGAAGGATCTGGAAGAGAGAAAAAATGATGCTGAGAAAGCCATCAAGGAGGCGCAAGTAGCTGCAG
CTTCAAGTTCTAATGGGAAGGAGGAACTTAAACCAGTTGCGACTGCAGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail