Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|047000
Gene name
Locationscaffold_02:2028708..2029716
Strand+
Gene length (bp)1008
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12352 V-SNARE_C Snare region anchored in the vesicle membrane C-terminus 4.6E-16 165 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7G5|BOS1_SCHPO Protein transport protein bos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bos1 PE=3 SV=1 2 252 1.0E-42
sp|Q6BZQ6|BOS1_YARLI Protein transport protein BOS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BOS1 PE=3 SV=1 1 252 4.0E-27
sp|Q6BVM4|BOS1_DEBHA Protein transport protein BOS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BOS1 PE=3 SV=1 1 252 8.0E-20
sp|O35166|GOSR2_MOUSE Golgi SNAP receptor complex member 2 OS=Mus musculus GN=Gosr2 PE=1 SV=2 1 252 1.0E-18
sp|O35165|GOSR2_RAT Golgi SNAP receptor complex member 2 OS=Rattus norvegicus GN=Gosr2 PE=1 SV=2 1 252 4.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7G5|BOS1_SCHPO Protein transport protein bos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bos1 PE=3 SV=1 2 252 1.0E-42
sp|Q6BZQ6|BOS1_YARLI Protein transport protein BOS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BOS1 PE=3 SV=1 1 252 4.0E-27
sp|Q6BVM4|BOS1_DEBHA Protein transport protein BOS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BOS1 PE=3 SV=1 1 252 8.0E-20
sp|O35166|GOSR2_MOUSE Golgi SNAP receptor complex member 2 OS=Mus musculus GN=Gosr2 PE=1 SV=2 1 252 1.0E-18
sp|O35165|GOSR2_RAT Golgi SNAP receptor complex member 2 OS=Rattus norvegicus GN=Gosr2 PE=1 SV=2 1 252 4.0E-16
sp|O14653|GOSR2_HUMAN Golgi SNAP receptor complex member 2 OS=Homo sapiens GN=GOSR2 PE=1 SV=2 171 252 2.0E-14
sp|Q75CY3|BOS1_ASHGO Protein transport protein BOS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BOS1 PE=3 SV=2 1 253 7.0E-14
sp|P25385|BOS1_YEAST Protein transport protein BOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOS1 PE=1 SV=1 1 235 2.0E-13
sp|Q9VRL2|GOSR2_DROME Probable Golgi SNAP receptor complex member 2 OS=Drosophila melanogaster GN=Membrin PE=2 SV=1 151 252 4.0E-13
sp|Q6FKA1|BOS1_CANGA Protein transport protein BOS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BOS1 PE=3 SV=1 1 252 1.0E-12
sp|A8XP14|GOSR2_CAEBR Probable Golgi SNAP receptor complex member 2 OS=Caenorhabditis briggsae GN=gosr-2.1 PE=3 SV=1 15 249 3.0E-10
sp|Q9SJL6|MEM11_ARATH Membrin-11 OS=Arabidopsis thaliana GN=MEMB11 PE=1 SV=1 158 247 2.0E-09
sp|Q9FK28|MEM12_ARATH Membrin-12 OS=Arabidopsis thaliana GN=MEMB12 PE=2 SV=1 171 247 3.0E-08
sp|P41941|GOSR2_CAEEL Probable Golgi SNAP receptor complex member 2 OS=Caenorhabditis elegans GN=gosr-2.1 PE=3 SV=1 1 249 6.0E-07
sp|Q6CRX0|BOS1_KLULA Protein transport protein BOS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BOS1 PE=3 SV=1 1 230 9.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 233 252 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup5754
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|047000 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|047000
Rhodonia placenta FPRL280 RhoplFPRL280|142_20

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|047000
MNSLYTSGVRQTTSLQADLERLRNGDVSASLLGQISASLAAMSRTVDDYDAMAKREIIKAKQEKAQMRVQKFRLD
YSEFRIQFEKLKADVLEQQSTSQRAELISSSATSNTTTPTSDTRRRFQTTPGPSTLHPGLRPSNTSDTISESPFR
SSSPYGNYGQESRALDEHTFIHNTDSKLDEFLAQGKEVLDNLVDQRKMLKGTRKRLLDAANTLGLSRQVIGWIER
RSTQDTYIFFGGAVFTFFCFYLIWHYFG*
Coding >AgabiH39|047000
ATGAACTCTCTATACACATCTGGTGTACGGCAAACAACATCTCTTCAAGCCGACCTCGAGCGTCTACGGAATGGG
GACGTTTCCGCCTCACTCCTTGGACAGATATCGGCTTCTCTAGCGGCTATGAGTCGGACTGTAGACGACTATGAT
GCTATGGCCAAACGAGAGATTATTAAAGCCAAACAGGAAAAGGCGCAAATGCGTGTGCAGAAATTTCGGTTGGAT
TATTCAGAGTTTCGGATTCAGTTTGAGAAATTGAAAGCGGATGTATTGGAACAGCAATCAACTTCTCAACGGGCG
GAACTCATCTCAAGTTCGGCGACTTCAAATACTACTACTCCTACGTCCGATACACGACGACGTTTCCAAACGACA
CCAGGACCCTCAACACTTCATCCCGGTCTCCGACCTTCCAACACCTCCGACACCATCTCAGAATCACCCTTCCGT
TCTTCATCACCTTATGGCAATTATGGTCAAGAGTCCCGCGCCTTGGACGAACATACTTTCATCCACAATACAGAT
AGCAAACTAGATGAGTTCTTGGCGCAGGGCAAGGAAGTATTGGATAATTTGGTGGATCAGAGAAAGATGTTGAAA
GGGACTCGTAAACGACTGTTGGATGCTGCGAACACTCTTGGGTTGAGTCGACAAGTAATTGGTTGGATTGAAAGA
CGAAGTACGCAAGACACGTATATCTTCTTCGGAGGAGCCGTTTTCACATTCTTCTGTTTCTATCTCATATGGCAC
TATTTCGGTTAA
Transcript >AgabiH39|047000
ATGAACTCTCTATACACATCTGGTGTACGGCAAACAACATCTCTTCAAGCCGACCTCGAGCGTCTACGGAATGGG
GACGTTTCCGCCTCACTCCTTGGACAGATATCGGCTTCTCTAGCGGCTATGAGTCGGACTGTAGACGACTATGAT
GCTATGGCCAAACGAGAGATTATTAAAGCCAAACAGGAAAAGGCGCAAATGCGTGTGCAGAAATTTCGGTTGGAT
TATTCAGAGTTTCGGATTCAGTTTGAGAAATTGAAAGCGGATGTATTGGAACAGCAATCAACTTCTCAACGGGCG
GAACTCATCTCAAGTTCGGCGACTTCAAATACTACTACTCCTACGTCCGATACACGACGACGTTTCCAAACGACA
CCAGGACCCTCAACACTTCATCCCGGTCTCCGACCTTCCAACACCTCCGACACCATCTCAGAATCACCCTTCCGT
TCTTCATCACCTTATGGCAATTATGGTCAAGAGTCCCGCGCCTTGGACGAACATACTTTCATCCACAATACAGAT
AGCAAACTAGATGAGTTCTTGGCGCAGGGCAAGGAAGTATTGGATAATTTGGTGGATCAGAGAAAGATGTTGAAA
GGGACTCGTAAACGACTGTTGGATGCTGCGAACACTCTTGGGTTGAGTCGACAAGTAATTGGTTGGATTGAAAGA
CGAAGTACGCAAGACACGTATATCTTCTTCGGAGGAGCCGTTTTCACATTCTTCTGTTTCTATCTCATATGGCAC
TATTTCGGTTAA
Gene >AgabiH39|047000
ATGAACTCTCTATACACATCTGGTGTACGGCAAACAACATCTCTTCAAGCCGACCTCGAGCGTCTACGGAATGGG
GACGTTTCCGCCTCACTCCTTGGTGCGTAGCCCATTTCCTACATGCATCGTATAGCAGCGGTGGTCATATTTTTT
TGCTTTTGTTTTTGTTTTTGTTAGGACAGATATCGGCTTCTCTAGCGGCTATGAGTCGGACTGTAGACGACTATG
ATGCTATGGCCAAACGAGAGATTATTAAAGCCAAACAGGAAAAGGCGCAAATGTGCGCAGTGTCTTTTTGCCATT
AGAGAGAGAGATTAAAATGGAAAGCGTTTAGGCGTGTGCAGAAATTTCGGTTGGATTATTCAGAGTTTCGGATTC
AGTTTGAGAAATTGAAAGCGGATGTATTGGAACAGGTGAGTGTTTTGCTTTTTTGTGTTGCATCGAGTTAGATTT
ATGGAGCCTTTCGTATAAAAGCAATCAACTTCTCAACGGGCGGAACTCATCTCAAGTTCGGCGACTTCAAATACT
ACTACTCCTACGTCCGATACACGACGACGTTTCCAAACGACACCAGGACCCTCAACACTTCATCCCGGTCTCCGA
CCTTCCAACACCTCCGACACCATCTCAGAATCACCCTTCCGTTCTTCATCACCTTATGGCAATTATGGTCAAGAG
TCCCGCGCCTTGGACGAACATACTTTCATCCACAATACAGATAGCAAACTAGATGAGTTCTTGGCGCAGGGCAAG
GAAGTATTGGATAATTTGGTGGATCAGAGAAAGATGTTGAAAGGGACTCGTAAACGACTGTTGGATGCTGCGAAC
ACTCTTGGGTTGAGTCGACAAGTAATTGGTTGGATTGAAAGACGAAGGTACGTTTTCCATTATCACTTTTCCCTA
AAGCACGCCCTAAATCTGTTTTTCAGTACGCAAGACACGTATATCTTCTTCGGAGGAGCCGTTTTCACATTCTTC
TGTTTCTATCTCATATGGCACTATTTCGGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail