Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|046560
Gene name
Locationscaffold_02:1909294..1911774
Strand+
Gene length (bp)2480
Transcript length (bp)1902
Coding sequence length (bp)1902
Protein length (aa) 634

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04049 ANAPC8 Anaphase promoting complex subunit 8 / Cdc23 3.7E-20 12 171
PF13181 TPR_8 Tetratricopeptide repeat 1.5E-01 375 406
PF13181 TPR_8 Tetratricopeptide repeat 3.9E-05 409 441
PF13181 TPR_8 Tetratricopeptide repeat 5.3E-03 477 503
PF13414 TPR_11 TPR repeat 1.3E-06 415 454
PF13432 TPR_16 Tetratricopeptide repeat 2.5E-06 414 453
PF13176 TPR_7 Tetratricopeptide repeat 1.1E-02 481 503

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94556|APC8_SCHPO Anaphase-promoting complex subunit 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut23 PE=1 SV=2 21 606 2.0E-124
sp|Q9STS3|CDC23_ARATH Anaphase-promoting complex subunit 8 OS=Arabidopsis thaliana GN=APC8 PE=1 SV=1 14 539 3.0E-94
sp|P16522|CDC23_YEAST Anaphase-promoting complex subunit CDC23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC23 PE=1 SV=1 119 599 2.0E-85
sp|Q9UJX2|CDC23_HUMAN Cell division cycle protein 23 homolog OS=Homo sapiens GN=CDC23 PE=1 SV=3 118 578 3.0E-85
sp|A1A4R8|CDC23_BOVIN Cell division cycle protein 23 homolog OS=Bos taurus GN=CDC23 PE=2 SV=1 118 578 4.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94556|APC8_SCHPO Anaphase-promoting complex subunit 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut23 PE=1 SV=2 21 606 2.0E-124
sp|Q9STS3|CDC23_ARATH Anaphase-promoting complex subunit 8 OS=Arabidopsis thaliana GN=APC8 PE=1 SV=1 14 539 3.0E-94
sp|P16522|CDC23_YEAST Anaphase-promoting complex subunit CDC23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC23 PE=1 SV=1 119 599 2.0E-85
sp|Q9UJX2|CDC23_HUMAN Cell division cycle protein 23 homolog OS=Homo sapiens GN=CDC23 PE=1 SV=3 118 578 3.0E-85
sp|A1A4R8|CDC23_BOVIN Cell division cycle protein 23 homolog OS=Bos taurus GN=CDC23 PE=2 SV=1 118 578 4.0E-85
sp|Q8BGZ4|CDC23_MOUSE Cell division cycle protein 23 homolog OS=Mus musculus GN=Cdc23 PE=1 SV=2 118 578 4.0E-84
sp|Q86B11|CDC23_DICDI Anaphase-promoting complex subunit 8 OS=Dictyostelium discoideum GN=anapc8 PE=3 SV=1 204 562 3.0E-79
sp|Q19294|CDC23_CAEEL Cell division cycle protein 23 homolog OS=Caenorhabditis elegans GN=mat-3 PE=1 SV=2 130 529 2.0E-47
sp|P17885|BIMA_EMENI Protein bimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimA PE=2 SV=1 305 531 1.0E-34
sp|Q8LGU6|CD27B_ARATH Cell division cycle protein 27 homolog B OS=Arabidopsis thaliana GN=CDC27B PE=1 SV=1 304 531 4.0E-30
sp|A7Z061|CDC27_BOVIN Cell division cycle protein 27 homolog OS=Bos taurus GN=CDC27 PE=2 SV=1 304 508 3.0E-29
sp|P30260|CDC27_HUMAN Cell division cycle protein 27 homolog OS=Homo sapiens GN=CDC27 PE=1 SV=2 304 508 3.0E-29
sp|A2A6Q5|CDC27_MOUSE Cell division cycle protein 27 homolog OS=Mus musculus GN=Cdc27 PE=1 SV=1 304 508 3.0E-28
sp|Q4V8A2|CDC27_RAT Cell division cycle protein 27 homolog OS=Rattus norvegicus GN=Cdc27 PE=2 SV=1 304 508 3.0E-28
sp|Q06AN9|CD27A_ARATH Cell division cycle protein 27 homolog A OS=Arabidopsis thaliana GN=CDC27A PE=1 SV=2 304 580 1.0E-26
sp|P10505|APC3_SCHPO Anaphase-promoting complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nuc2 PE=1 SV=3 304 502 1.0E-26
sp|P38042|CDC27_YEAST Anaphase-promoting complex subunit CDC27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC27 PE=1 SV=2 307 502 7.0E-25
sp|Q54J83|APC3_DICDI Anaphase-promoting complex subunit 3 OS=Dictyostelium discoideum GN=anapc3 PE=3 SV=1 305 472 6.0E-23
sp|Q9N593|CDC27_CAEEL Cell division cycle protein 27 homolog OS=Caenorhabditis elegans GN=mat-1 PE=1 SV=1 312 449 9.0E-15
sp|O60184|CYC8_SCHPO General transcriptional corepressor ssn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssn6 PE=1 SV=1 311 517 1.0E-12
sp|Q9FMA3|PEX5_ARATH Peroxisome biogenesis protein 5 OS=Arabidopsis thaliana GN=PEX5 PE=1 SV=1 359 503 9.0E-10
sp|O77033|CYC8_DICDI General transcriptional corepressor trfA OS=Dictyostelium discoideum GN=trfA PE=2 SV=1 311 520 2.0E-09
sp|Q8VY89|APC7_ARATH Anaphase-promoting complex subunit 7 OS=Arabidopsis thaliana GN=APC7 PE=2 SV=1 302 521 4.0E-09
sp|Q58208|Y798_METJA TPR repeat-containing protein MJ0798 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0798 PE=3 SV=1 415 540 6.0E-08
sp|P14922|CYC8_YEAST General transcriptional corepressor CYC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYC8 PE=1 SV=2 311 502 2.0E-07
sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 313 538 1.0E-06
sp|P19737|Y425_SYNP2 TPR repeat-containing protein SYNPCC7002_A0425 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=SYNPCC7002_A0425 PE=3 SV=2 408 559 3.0E-06
sp|Q8R349|CDC16_MOUSE Cell division cycle protein 16 homolog OS=Mus musculus GN=Cdc16 PE=1 SV=1 317 544 7.0E-06
sp|Q13042|CDC16_HUMAN Cell division cycle protein 16 homolog OS=Homo sapiens GN=CDC16 PE=1 SV=2 332 544 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005680 anaphase-promoting complex Yes
GO:0005515 protein binding Yes
GO:0030071 regulation of mitotic metaphase/anaphase transition Yes
GO:0140535 intracellular protein-containing complex No
GO:0008150 biological_process No
GO:1905818 regulation of chromosome separation No
GO:1902494 catalytic complex No
GO:0010965 regulation of mitotic sister chromatid separation No
GO:0003674 molecular_function No
GO:0033045 regulation of sister chromatid segregation No
GO:0051726 regulation of cell cycle No
GO:1902099 regulation of metaphase/anaphase transition of cell cycle No
GO:1901987 regulation of cell cycle phase transition No
GO:0050794 regulation of cellular process No
GO:0050789 regulation of biological process No
GO:0051128 regulation of cellular component organization No
GO:0140513 nuclear protein-containing complex No
GO:0005488 binding No
GO:0065007 biological regulation No
GO:0000152 nuclear ubiquitin ligase complex No
GO:1901990 regulation of mitotic cell cycle phase transition No
GO:0033043 regulation of organelle organization No
GO:1990234 transferase complex No
GO:0010564 regulation of cell cycle process No
GO:0051983 regulation of chromosome segregation No
GO:0033044 regulation of chromosome organization No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0032991 protein-containing complex No
GO:0000151 ubiquitin ligase complex No
GO:0007346 regulation of mitotic cell cycle No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1637
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|046560 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|046560
Rhodonia placenta FPRL280 RhoplFPRL280|11_75

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|046560
MDSAFHVDAQTAAELRAAAKECSERGLVVATKWASELLLALPLSKRRNLADSVPILHYSTSTPAHSKSHELSLSF
SDAPSPLPAQGVRHNPTHSGGTIVTHVPSSHGHTGDLQTSEKELEEQDADMLNAARSFIESKEFARAIHVLQGAR
SGKASFIRVYSKFMANEKKAVRDWHKLDNNRLQPPVPVDNTLSELLNEVHDTEDPWLLFLKSLFLSRLSRREEAM
ECALLSIAGLPWNWSCWTLLGSCIGDGEELSSLLQLVPLSPTHPLVHMFQIKTLSELHQPTENELALCDRLLSAD
FFPNSAWLMSLRACVLYHLHEFGQAEQQFEKILAQDPYRIDDIDIYSNILYVTDNKLKLSRLAHEFLALDKDRPE
ICCLVGNHYSLRAEHEKAVKYFRRATQLDRTYLSAWTLMGHEYVEMKNSHAAIEAYRRAVDVNRKDYRAWYGLGQ
AYELLSMHHYSLYYYRHATALRPYDIRLWQAQGLCYEEIGRRREAIECYKRALIPADPHEININLKLANLYWSLD
ELPEAVAYHRRVVEVCQANLRPIQEYAKSCLQVAEYHMGISGGDLYLAKEYLERVASSNAEDVMKATELLKAVKS
TLQAGHQNGVGSENQTSQPSEGETSKNSESRER*
Coding >AgabiH39|046560
ATGGATTCTGCGTTCCATGTAGATGCACAAACTGCTGCTGAGCTGCGTGCCGCAGCCAAGGAATGCTCTGAAAGG
GGCCTGGTAGTTGCAACAAAATGGGCCTCAGAACTGCTGCTTGCCCTTCCGCTTTCGAAACGCAGAAATTTGGCT
GATTCAGTACCTATACTTCATTATTCAACGTCAACACCAGCCCATTCAAAATCTCACGAGCTTTCTCTCTCGTTT
TCTGACGCTCCTTCACCGCTTCCGGCACAGGGTGTGCGACATAATCCGACACATTCTGGTGGTACTATTGTTACT
CATGTCCCATCTTCGCATGGACACACTGGCGACCTGCAGACTTCCGAGAAAGAACTAGAAGAGCAGGACGCCGAT
ATGTTGAATGCCGCTCGCTCCTTCATTGAATCAAAAGAGTTTGCGCGTGCCATCCACGTCCTGCAGGGTGCCCGG
AGTGGGAAGGCGAGTTTCATCAGAGTGTACAGCAAATTCATGGCAAATGAAAAGAAAGCCGTGCGGGATTGGCAC
AAGCTGGATAATAATCGACTACAGCCACCCGTTCCGGTGGATAATACTCTGAGTGAACTTCTTAATGAGGTACAT
GATACCGAAGACCCTTGGCTATTGTTCCTTAAATCACTCTTTCTCTCGCGGCTCTCACGTCGGGAAGAAGCGATG
GAGTGTGCGTTGTTGTCTATTGCCGGTCTACCTTGGAATTGGTCCTGTTGGACACTTCTGGGAAGCTGCATCGGT
GATGGAGAAGAGCTGTCATCCCTTCTTCAATTGGTGCCGTTAAGTCCGACACACCCATTGGTTCACATGTTCCAA
ATCAAAACTCTTAGTGAGCTTCACCAGCCAACTGAAAACGAGTTGGCTCTTTGTGATCGCCTCTTGAGCGCGGAC
TTCTTTCCAAATAGCGCGTGGCTCATGAGCTTGCGTGCCTGCGTTCTTTATCACTTACATGAGTTTGGACAAGCC
GAGCAACAATTCGAAAAAATTTTGGCTCAGGATCCTTACCGGATTGATGACATTGACATCTATTCGAATATTCTC
TATGTCACTGATAACAAACTCAAACTTTCGCGACTTGCACACGAATTCTTGGCATTGGACAAAGATAGGCCCGAG
ATTTGCTGTCTTGTAGGGAATCATTACTCACTTCGTGCAGAACATGAGAAAGCGGTGAAATATTTCCGAAGAGCC
ACGCAGCTTGATCGAACATATCTTTCGGCGTGGACACTGATGGGACACGAGTACGTAGAAATGAAGAATTCGCAT
GCTGCTATCGAGGCTTACCGCCGAGCTGTTGATGTCAACCGCAAAGATTACCGAGCATGGTACGGATTAGGTCAA
GCCTACGAGCTGCTCAGTATGCATCATTACTCGCTCTATTATTATCGGCATGCAACGGCGTTGAGACCTTATGAT
ATCAGGTTGTGGCAAGCTCAGGGCTTGTGCTACGAAGAGATCGGGCGTCGAAGGGAAGCTATTGAATGCTACAAG
CGTGCACTGATTCCAGCAGATCCACATGAGATCAACATCAATTTAAAGCTGGCCAATCTGTATTGGTCGTTGGAT
GAGCTTCCAGAAGCAGTGGCTTACCACCGACGTGTCGTTGAAGTTTGCCAAGCCAATCTCCGGCCCATCCAGGAG
TATGCGAAGTCTTGTCTACAGGTGGCAGAATATCATATGGGGATTTCTGGTGGGGACCTGTACTTAGCCAAGGAA
TACCTTGAGCGAGTGGCGAGCAGTAATGCAGAGGATGTGATGAAAGCAACTGAACTACTCAAGGCGGTGAAATCA
ACTCTCCAGGCCGGGCACCAGAACGGGGTAGGGTCGGAAAATCAAACCTCGCAGCCATCAGAAGGAGAAACGTCG
AAAAATTCTGAATCAAGGGAACGTTAA
Transcript >AgabiH39|046560
ATGGATTCTGCGTTCCATGTAGATGCACAAACTGCTGCTGAGCTGCGTGCCGCAGCCAAGGAATGCTCTGAAAGG
GGCCTGGTAGTTGCAACAAAATGGGCCTCAGAACTGCTGCTTGCCCTTCCGCTTTCGAAACGCAGAAATTTGGCT
GATTCAGTACCTATACTTCATTATTCAACGTCAACACCAGCCCATTCAAAATCTCACGAGCTTTCTCTCTCGTTT
TCTGACGCTCCTTCACCGCTTCCGGCACAGGGTGTGCGACATAATCCGACACATTCTGGTGGTACTATTGTTACT
CATGTCCCATCTTCGCATGGACACACTGGCGACCTGCAGACTTCCGAGAAAGAACTAGAAGAGCAGGACGCCGAT
ATGTTGAATGCCGCTCGCTCCTTCATTGAATCAAAAGAGTTTGCGCGTGCCATCCACGTCCTGCAGGGTGCCCGG
AGTGGGAAGGCGAGTTTCATCAGAGTGTACAGCAAATTCATGGCAAATGAAAAGAAAGCCGTGCGGGATTGGCAC
AAGCTGGATAATAATCGACTACAGCCACCCGTTCCGGTGGATAATACTCTGAGTGAACTTCTTAATGAGGTACAT
GATACCGAAGACCCTTGGCTATTGTTCCTTAAATCACTCTTTCTCTCGCGGCTCTCACGTCGGGAAGAAGCGATG
GAGTGTGCGTTGTTGTCTATTGCCGGTCTACCTTGGAATTGGTCCTGTTGGACACTTCTGGGAAGCTGCATCGGT
GATGGAGAAGAGCTGTCATCCCTTCTTCAATTGGTGCCGTTAAGTCCGACACACCCATTGGTTCACATGTTCCAA
ATCAAAACTCTTAGTGAGCTTCACCAGCCAACTGAAAACGAGTTGGCTCTTTGTGATCGCCTCTTGAGCGCGGAC
TTCTTTCCAAATAGCGCGTGGCTCATGAGCTTGCGTGCCTGCGTTCTTTATCACTTACATGAGTTTGGACAAGCC
GAGCAACAATTCGAAAAAATTTTGGCTCAGGATCCTTACCGGATTGATGACATTGACATCTATTCGAATATTCTC
TATGTCACTGATAACAAACTCAAACTTTCGCGACTTGCACACGAATTCTTGGCATTGGACAAAGATAGGCCCGAG
ATTTGCTGTCTTGTAGGGAATCATTACTCACTTCGTGCAGAACATGAGAAAGCGGTGAAATATTTCCGAAGAGCC
ACGCAGCTTGATCGAACATATCTTTCGGCGTGGACACTGATGGGACACGAGTACGTAGAAATGAAGAATTCGCAT
GCTGCTATCGAGGCTTACCGCCGAGCTGTTGATGTCAACCGCAAAGATTACCGAGCATGGTACGGATTAGGTCAA
GCCTACGAGCTGCTCAGTATGCATCATTACTCGCTCTATTATTATCGGCATGCAACGGCGTTGAGACCTTATGAT
ATCAGGTTGTGGCAAGCTCAGGGCTTGTGCTACGAAGAGATCGGGCGTCGAAGGGAAGCTATTGAATGCTACAAG
CGTGCACTGATTCCAGCAGATCCACATGAGATCAACATCAATTTAAAGCTGGCCAATCTGTATTGGTCGTTGGAT
GAGCTTCCAGAAGCAGTGGCTTACCACCGACGTGTCGTTGAAGTTTGCCAAGCCAATCTCCGGCCCATCCAGGAG
TATGCGAAGTCTTGTCTACAGGTGGCAGAATATCATATGGGGATTTCTGGTGGGGACCTGTACTTAGCCAAGGAA
TACCTTGAGCGAGTGGCGAGCAGTAATGCAGAGGATGTGATGAAAGCAACTGAACTACTCAAGGCGGTGAAATCA
ACTCTCCAGGCCGGGCACCAGAACGGGGTAGGGTCGGAAAATCAAACCTCGCAGCCATCAGAAGGAGAAACGTCG
AAAAATTCTGAATCAAGGGAACGTTAA
Gene >AgabiH39|046560
ATGGATTCTGCGTTCCATGTAGATGCACAAACTGCTGCTGAGCTGCGTGCCGCAGCCAAGGAATGCTCTGAAAGG
GGCCTGGTAGTTGCAACAAAATGGTGCGTTTCCGATTATTTCGTGGTATTGTACTGAGGAGCTGCTGTAGGGCCT
CAGAACTGCTGCTTGCCCTTCCGCTTTCGAAACGCAGAAATTTGGCTGATTCAGTACCTATACTTCATTATTCAA
CGTCAACACCAGCCCATTCAAAATCTCACGAGCTTTCTCTCTCGTTTTCTGACGCTCCTTCACCGCTTCCGGCAC
AGGGTGTGCGACATAATCCGACACATTCTGGTGGTACTATTGTTACTCATGTCCCATCTTCGCATGGACACACTG
GCGACCTGCAGACTTCCGAGAAAGAACTAGAAGAGCAGGACGCCGATATGTTGAATGCCGCTCGCTCCTTCATTG
AATCAAAAGAGTTTGCGCGTGCCATCCACGTCCTGCAGGGTGCCCGGAGTGGGAAGGCGAGTTTCATCAGAGTGT
ACAGCAAATTCATGGTGGGATTGCCACTGAATATAGTGCGCGTAAATTCTTAATCAGAGTTCAACGCCTAGGCAA
ATGAAAAGAAAGCCGTGCGGGATTGGCACAAGCTGGATAGTAAGTTGCACTGCTTCCAGTTTCGCAGTCATAGGT
TTCTCAACCGAACAGATAATCGACTACAGCCACCCGTTCCGGTGGATAATACTCTGAGTGAACTTCTTAATGAGG
TACATGATACCGAAGACCCTTGGCTATTGTTCCTGTGTGCCCAGCATAACATTCTCATATCCACGCGATGCTGAT
CTCTGATAGTAAATCACTCTTTCTCTCGCGGCTCTCACGTCGGGAAGAAGCGATGGAGTGTGCGTTGTTGTCTAT
TGCCGGTCTACCTTGGAATTGGTCCTGTTGGACACTTCTGGGAAGCTGCATCGGTGATGGAGAAGAGGTGACCGA
GAGTATCCCAATAGTTGGTATTCGCTAACTTCCCGGTTCCAGCTGTCATCCCTTCTTCAATTGGTGCCGTTAAGT
CCGACACACCCATTGGTTCACATGTTCCAAATCAAAACTCTTAGTGAGCTTCACCAGCCAACTGAAAACGAGTTG
GCTCTTTGTGATCGCCTCTTGAGCGCGGACTTCTTTCCAAATAGCGCGTGGCTCATGAGCTTGCGTGCCTGCGTT
CTTTATCACTTACATGGTTAATCTTCCGCGTTGTCTTGCTTCTTCATCACTGAGGATTCTCTCAGAGTTTGGACA
AGCCGAGCAACAATTCGAAAAAATTTTGGCTCAGGATCCTTACCGGATTGATGACATTGACATCTATTCGAATAT
TCTCTATGTCACTGATAACAAACTCAAACTTTCGCGACTTGCACACGAATTCTTGGCATTGGACAAAGATAGGCC
CGAGATTTGCTGTCTTGTAGGTGAGAAAAGATCTGATTGTTCGATTGAAAATTTTCTAATATGACGCACAGGGAA
TCATTACTCACTTCGTGCAGAACATGAGAAAGCGGTGAAATATTTCCGAAGAGCCACGCAGCTTGATCGAACATA
TCTTTCGGCGTGGACACTGATGGGACACGAGTACGTAGAAATGAAGAATTCGCATGCTGCTATCGAGGCTTACCG
CCGAGCTGTTGGTAAAGCTTCTTCTTCCAGATTTGGGGTACTCTTTTCTCAAAGTTGTGACTAGATGTCAACCGC
AAAGATTACCGAGCATGGTACGGATTAGGTCAAGCCTACGAGCTGCTCAGTATGCATCATTACTCGCTCTATTAT
TATCGGCATGCAACGGCGTTGAGGTGCGAACGTTTCCGCTTAGTGCAGGTACAAAATTTTCACTACTTGTCACAG
ACCTTATGATATCAGGTTGTGGCAAGCTCAGGGCTTGTGCTACGAAGAGATCGGGCGGTATTTTTCTGTCCCCGA
GCTGTGACTTCTACGAGCTGACTGTTCGTGTGGTCCTCTCAGTCGAAGGGAAGCTATTGAATGCTACAAGCGTGC
ACTGATTCCAGCAGATCCACATGAGATCAACATCAATTTAAAGCTGGCCAATCTGTATTGGTCGTTGGATGAGCT
TCCAGAAGCAGTGGCTTACCACCGACGTGTCGTTGAAGTTTGCCAAGCCAATCGTTGAGTGTTACCAACACCGTG
GGCCGTTGTAAATTTCGTTGACTAACATGTTTCCAGTCCGGCCCATCCAGGAGTATGCGAAGTCTTGTCTACAGG
TGGCAGAATATCATATGGGGATTTCTGGTGGGGACCTGTACTTAGCCAAGGAATACCTTGAGCGAGTGGCGAGCA
GTAATGCAGAGGATGTGATGAAAGCAACTGAACTACTCAAGGCGGTGAAATCAACTCTCCAGGCCGGGCACCAGA
ACGGGGTAGGGTCGGAAAATCAAACCTCGCAGCCATCAGAAGGAGAAACGTCGAAAAATTCTGAATCAAGGGAAC
GTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail