Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|042120
Gene name
Locationscaffold_02:791776..794693
Strand-
Gene length (bp)2917
Transcript length (bp)2040
Coding sequence length (bp)2040
Protein length (aa) 680

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 2.6E-43 104 535

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A3QK15|AACS_DANRE Acetoacetyl-CoA synthetase OS=Danio rerio GN=aacs PE=2 SV=1 7 656 0.0E+00
sp|Q5ZLG0|AACS_CHICK Acetoacetyl-CoA synthetase OS=Gallus gallus GN=AACS PE=2 SV=1 7 656 0.0E+00
sp|Q28BL6|AACS_XENTR Acetoacetyl-CoA synthetase OS=Xenopus tropicalis GN=aacs PE=2 SV=1 7 656 0.0E+00
sp|Q9JMI1|AACS_RAT Acetoacetyl-CoA synthetase OS=Rattus norvegicus GN=Aacs PE=1 SV=1 7 656 0.0E+00
sp|Q9D2R0|AACS_MOUSE Acetoacetyl-CoA synthetase OS=Mus musculus GN=Aacs PE=1 SV=1 7 656 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A3QK15|AACS_DANRE Acetoacetyl-CoA synthetase OS=Danio rerio GN=aacs PE=2 SV=1 7 656 0.0E+00
sp|Q5ZLG0|AACS_CHICK Acetoacetyl-CoA synthetase OS=Gallus gallus GN=AACS PE=2 SV=1 7 656 0.0E+00
sp|Q28BL6|AACS_XENTR Acetoacetyl-CoA synthetase OS=Xenopus tropicalis GN=aacs PE=2 SV=1 7 656 0.0E+00
sp|Q9JMI1|AACS_RAT Acetoacetyl-CoA synthetase OS=Rattus norvegicus GN=Aacs PE=1 SV=1 7 656 0.0E+00
sp|Q9D2R0|AACS_MOUSE Acetoacetyl-CoA synthetase OS=Mus musculus GN=Aacs PE=1 SV=1 7 656 0.0E+00
sp|Q9N0E1|AACS_MACFA Acetoacetyl-CoA synthetase OS=Macaca fascicularis GN=AACS PE=2 SV=1 7 656 0.0E+00
sp|Q86V21|AACS_HUMAN Acetoacetyl-CoA synthetase OS=Homo sapiens GN=AACS PE=1 SV=1 7 656 8.0E-180
sp|Q9Z3R3|AACS_RHIME Acetoacetyl-coenzyme A synthetase OS=Rhizobium meliloti (strain 1021) GN=acsA2 PE=3 SV=2 11 657 2.0E-148
sp|Q21166|SUR5_CAEEL Acetoacetyl-CoA synthetase OS=Caenorhabditis elegans GN=sur-5 PE=2 SV=1 14 654 2.0E-119
sp|Q973W5|HPCAS_SULTO 3-hydroxypropionyl-coenzyme A synthetase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_07830 PE=1 SV=1 29 668 1.0E-52
sp|A4YGR1|HPCAS_METS5 3-hydroxypropionyl-coenzyme A synthetase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1456 PE=1 SV=1 29 665 2.0E-49
sp|Q66FM8|ACSA_YERPS Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 38 657 2.0E-48
sp|A7FNG1|ACSA_YERP3 Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 38 657 2.0E-48
sp|A4TS06|ACSA_YERPP Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 38 657 3.0E-48
sp|Q1CE37|ACSA_YERPN Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acs PE=3 SV=1 38 657 3.0E-48
sp|Q8D1G8|ACSA_YERPE Acetyl-coenzyme A synthetase OS=Yersinia pestis GN=acs PE=3 SV=2 38 657 3.0E-48
sp|Q1C0N0|ACSA_YERPA Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acs PE=3 SV=1 38 657 3.0E-48
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 35 657 3.0E-48
sp|A1JIK3|ACSA_YERE8 Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acs PE=3 SV=1 35 658 5.0E-48
sp|Q72J95|ACSA_THET2 Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=acsA PE=3 SV=1 19 641 9.0E-48
sp|Q5SIW6|ACSA_THET8 Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=acsA PE=3 SV=1 19 641 9.0E-48
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 35 657 1.0E-47
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 35 657 6.0E-47
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 81 655 7.0E-47
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 35 657 1.0E-46
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 35 657 1.0E-46
sp|Q6LLZ1|ACSA_PHOPR Acetyl-coenzyme A synthetase OS=Photobacterium profundum GN=acsA PE=3 SV=1 35 657 2.0E-46
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 51 667 3.0E-46
sp|Q3IFM6|ACSA_PSEHT Acetyl-coenzyme A synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=acsA PE=3 SV=1 40 657 3.0E-46
sp|Q2NR28|ACSA_SODGM Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 35 665 5.0E-46
sp|Q8KBY0|ACSA_CHLTE Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 86 658 2.0E-45
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 35 657 3.0E-45
sp|Q9HV66|ACSA2_PSEAE Acetyl-coenzyme A synthetase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA2 PE=3 SV=1 29 663 3.0E-45
sp|Q9F7R5|ACSA_PRB01 Acetyl-coenzyme A synthetase OS=Gamma-proteobacterium EBAC31A08 GN=acsA PE=3 SV=1 26 657 9.0E-45
sp|Q15YI8|ACSA_PSEA6 Acetyl-coenzyme A synthetase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=acsA PE=3 SV=1 35 657 1.0E-44
sp|B1M0M1|ACSA_METRJ Acetyl-coenzyme A synthetase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=acsA PE=3 SV=1 32 651 2.0E-44
sp|A8G8G7|ACSA_SERP5 Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) GN=acs PE=3 SV=1 51 658 4.0E-44
sp|Q9KV59|ACSA_VIBCH Acetyl-coenzyme A synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=acsA PE=3 SV=2 86 657 7.0E-44
sp|Q7MBA6|ACSA_PHOLL Acetyl-coenzyme A synthetase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=acs PE=3 SV=1 35 665 1.0E-43
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 86 651 2.0E-43
sp|Q2LW77|ACSA_SYNAS Acetyl-coenzyme A synthetase OS=Syntrophus aciditrophicus (strain SB) GN=acsA PE=3 SV=1 86 651 2.0E-43
sp|Q87C00|ACSA_XYLFT Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acsA PE=3 SV=1 86 663 2.0E-43
sp|A1WY97|ACSA_HALHL Acetyl-coenzyme A synthetase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=acsA PE=3 SV=1 29 657 2.0E-43
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 86 663 6.0E-43
sp|Q9PB89|ACSA_XYLFA Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain 9a5c) GN=acsA PE=3 SV=1 86 657 9.0E-43
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 19 657 1.0E-42
sp|C1AA44|ACSA_GEMAT Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 81 657 2.0E-42
sp|B8FIN2|ACSA_DESAA Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 86 657 2.0E-42
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 35 663 2.0E-42
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 35 663 2.0E-42
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 86 657 3.0E-42
sp|Q885K7|ACSA_PSESM Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=acsA PE=3 SV=1 86 665 3.0E-42
sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 86 657 4.0E-42
sp|Q7M9Y2|ACSA_WOLSU Acetyl-coenzyme A synthetase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=acsA PE=3 SV=1 86 651 4.0E-42
sp|Q48G09|ACSA_PSE14 Acetyl-coenzyme A synthetase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=acsA PE=3 SV=1 86 657 1.0E-41
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 86 657 1.0E-41
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 85 657 1.0E-41
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 86 657 2.0E-41
sp|Q056J9|ACSA_LEPBL Acetyl-coenzyme A synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=acsA PE=3 SV=1 31 657 2.0E-41
sp|Q04P35|ACSA_LEPBJ Acetyl-coenzyme A synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=acsA PE=3 SV=1 31 657 3.0E-41
sp|A4YK73|ACSA_BRASO Acetyl-coenzyme A synthetase OS=Bradyrhizobium sp. (strain ORS278) GN=acsA PE=3 SV=1 40 651 4.0E-41
sp|Q8EYG2|ACSA_LEPIN Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=acsA PE=3 SV=1 86 657 5.0E-41
sp|B2IB12|ACSA_BEII9 Acetyl-coenzyme A synthetase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=acsA PE=3 SV=1 30 651 7.0E-41
sp|Q9I558|ACSA1_PSEAE Acetyl-coenzyme A synthetase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA1 PE=3 SV=1 86 657 8.0E-41
sp|A3QD52|ACSA_SHELP Acetyl-coenzyme A synthetase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=acsA PE=3 SV=1 86 664 9.0E-41
sp|Q39EK2|ACSA_BURL3 Acetyl-coenzyme A synthetase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=acsA PE=3 SV=1 86 657 1.0E-40
sp|Q1H0J2|ACSA_METFK Acetyl-coenzyme A synthetase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=acsA PE=3 SV=1 86 666 1.0E-40
sp|Q87KU7|ACSA_VIBPA Acetyl-coenzyme A synthetase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=acsA PE=3 SV=1 86 657 1.0E-40
sp|Q0VSR6|ACSA_ALCBS Acetyl-coenzyme A synthetase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=acsA PE=3 SV=1 85 657 1.0E-40
sp|A9W5V0|ACSA_METEP Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain PA1) GN=acsA PE=3 SV=1 40 651 2.0E-40
sp|Q72LY9|ACSA_LEPIC Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=acsA PE=3 SV=1 86 657 2.0E-40
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 18 655 2.0E-40
sp|Q17WR1|ACSA_HELAH Acetyl-coenzyme A synthetase OS=Helicobacter acinonychis (strain Sheeba) GN=acsA PE=3 SV=1 86 637 2.0E-40
sp|Q8XY11|ACSA_RALSO Acetyl-coenzyme A synthetase OS=Ralstonia solanacearum (strain GMI1000) GN=acsA PE=3 SV=1 85 657 4.0E-40
sp|Q6BS00|ACS2_DEBHA Acetyl-coenzyme A synthetase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS2 PE=3 SV=1 20 654 7.0E-40
sp|B2JD61|ACSA_BURP8 Acetyl-coenzyme A synthetase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=acsA PE=3 SV=1 86 657 7.0E-40
sp|B7KPN8|ACSA_METC4 Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=acsA PE=3 SV=1 40 651 7.0E-40
sp|Q82SI5|ACSA_NITEU Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 81 657 9.0E-40
sp|B1ZB59|ACSA_METPB Acetyl-coenzyme A synthetase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=acsA PE=3 SV=1 40 651 9.0E-40
sp|A4WJG1|ACSA_PYRAR Acetyl-coenzyme A synthetase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=acsA PE=3 SV=1 81 655 1.0E-39
sp|Q07VK4|ACSA_RHOP5 Acetyl-coenzyme A synthetase OS=Rhodopseudomonas palustris (strain BisA53) GN=acsA PE=3 SV=1 40 651 1.0E-39
sp|A8H5P1|ACSA_SHEPA Acetyl-coenzyme A synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=acsA PE=3 SV=1 86 664 1.0E-39
sp|A4VKA0|ACSA_PSEU5 Acetyl-coenzyme A synthetase OS=Pseudomonas stutzeri (strain A1501) GN=acsA PE=3 SV=1 86 651 2.0E-39
sp|Q0AAW0|ACSA_ALKEH Acetyl-coenzyme A synthetase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=acsA PE=3 SV=1 29 651 2.0E-39
sp|O60011|ACS1_KLULA Acetyl-coenzyme A synthetase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS1 PE=3 SV=2 22 657 3.0E-39
sp|Q88DW6|ACSA2_PSEPK Acetyl-coenzyme A synthetase 2 OS=Pseudomonas putida (strain KT2440) GN=acsA2 PE=3 SV=1 29 663 3.0E-39
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 86 654 3.0E-39
sp|Q084J4|ACSA_SHEFN Acetyl-coenzyme A synthetase OS=Shewanella frigidimarina (strain NCIMB 400) GN=acsA PE=3 SV=1 86 664 3.0E-39
sp|B6JKX8|ACSA_HELP2 Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain P12) GN=acsA PE=3 SV=1 86 637 3.0E-39
sp|A7IFD4|ACSA_XANP2 Acetyl-coenzyme A synthetase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acsA PE=3 SV=1 86 657 4.0E-39
sp|Q1CUA3|ACSA_HELPH Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain HPAG1) GN=acsA PE=3 SV=1 86 637 4.0E-39
sp|Q8EDK3|ACSA_SHEON Acetyl-coenzyme A synthetase OS=Shewanella oneidensis (strain MR-1) GN=acsA PE=3 SV=1 86 657 5.0E-39
sp|B0TPY4|ACSA_SHEHH Acetyl-coenzyme A synthetase OS=Shewanella halifaxensis (strain HAW-EB4) GN=acsA PE=3 SV=1 86 664 5.0E-39
sp|A1U2S9|ACSA_MARHV Acetyl-coenzyme A synthetase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=acsA PE=3 SV=1 14 651 7.0E-39
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 81 664 8.0E-39
sp|P78773|ACSA_SCHPO Probable acetyl-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC191.02c PE=1 SV=2 85 639 9.0E-39
sp|Q89WV5|ACSA_BRADU Acetyl-coenzyme A synthetase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acsA PE=1 SV=2 86 651 1.0E-38
sp|B3R1X2|ACSA_CUPTR Acetyl-coenzyme A synthetase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=acsA PE=3 SV=1 86 657 1.0E-38
sp|Q88EH6|ACSA1_PSEPK Acetyl-coenzyme A synthetase 1 OS=Pseudomonas putida (strain KT2440) GN=acsA1 PE=3 SV=1 86 657 1.0E-38
sp|A6VZN8|ACSA_MARMS Acetyl-coenzyme A synthetase OS=Marinomonas sp. (strain MWYL1) GN=acsA PE=3 SV=1 39 651 2.0E-38
sp|A0KY83|ACSA_SHESA Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain ANA-3) GN=acsA PE=3 SV=1 86 657 2.0E-38
sp|Q63NC4|ACSA_BURPS Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain K96243) GN=acsA PE=3 SV=1 86 657 2.0E-38
sp|A3NH07|ACSA_BURP6 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 668) GN=acsA PE=3 SV=1 86 657 2.0E-38
sp|Q3JH62|ACSA_BURP1 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1710b) GN=acsA PE=3 SV=1 86 657 2.0E-38
sp|A3P2K7|ACSA_BURP0 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1106a) GN=acsA PE=3 SV=1 86 657 2.0E-38
sp|A1UWN5|ACSA_BURMS Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain SAVP1) GN=acsA PE=3 SV=1 86 657 2.0E-38
sp|Q62AD1|ACSA_BURMA Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain ATCC 23344) GN=acsA PE=3 SV=1 86 657 2.0E-38
sp|A2RYW5|ACSA_BURM9 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10229) GN=acsA PE=3 SV=1 86 657 2.0E-38
sp|A3MG40|ACSA_BURM7 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10247) GN=acsA PE=3 SV=1 86 657 2.0E-38
sp|B2U6V1|ACSA_RALPJ Acetyl-coenzyme A synthetase OS=Ralstonia pickettii (strain 12J) GN=acsA PE=3 SV=1 86 657 2.0E-38
sp|O25686|ACSA_HELPY Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=acsA PE=3 SV=1 36 637 2.0E-38
sp|Q9A2I0|ACSA_CAUCR Acetyl-coenzyme A synthetase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=acsA PE=3 SV=1 62 651 2.0E-38
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 19 642 2.0E-38
sp|Q98ET8|ACSA_RHILO Acetyl-coenzyme A synthetase OS=Rhizobium loti (strain MAFF303099) GN=acsA PE=3 SV=1 86 651 2.0E-38
sp|Q0AFF1|ACSA_NITEC Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 81 651 3.0E-38
sp|B5Z6E9|ACSA_HELPG Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain G27) GN=acsA PE=3 SV=1 86 642 4.0E-38
sp|A4Y7Y7|ACSA_SHEPC Acetyl-coenzyme A synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=acsA PE=3 SV=1 86 657 4.0E-38
sp|A1RIK1|ACSA_SHESW Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain W3-18-1) GN=acsA PE=3 SV=1 86 657 4.0E-38
sp|A4SJM6|ACSA_AERS4 Acetyl-coenzyme A synthetase OS=Aeromonas salmonicida (strain A449) GN=acsA PE=3 SV=1 35 664 5.0E-38
sp|A0L576|ACSA_MAGMM Acetyl-coenzyme A synthetase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=acsA PE=3 SV=1 86 657 6.0E-38
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 16 651 7.0E-38
sp|Q758X0|ACS1_ASHGO Acetyl-coenzyme A synthetase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS1 PE=3 SV=1 85 657 7.0E-38
sp|Q2T3N9|ACSA_BURTA Acetyl-coenzyme A synthetase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=acsA PE=3 SV=1 86 657 8.0E-38
sp|A1S7C8|ACSA_SHEAM Acetyl-coenzyme A synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=acsA PE=3 SV=1 86 657 9.0E-38
sp|Q01574|ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS1 PE=1 SV=2 33 656 9.0E-38
sp|Q0HTY6|ACSA_SHESR Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 86 657 9.0E-38
sp|P31638|ACSA_CUPNH Acetyl-coenzyme A synthetase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acsA PE=3 SV=1 86 657 1.0E-37
sp|Q0HHN4|ACSA_SHESM Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 86 657 1.0E-37
sp|A7HSR8|ACSA_PARL1 Acetyl-coenzyme A synthetase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=acsA PE=3 SV=1 86 651 1.0E-37
sp|A1SZA2|ACSA_PSYIN Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 86 657 1.0E-37
sp|A8FUF1|ACSA_SHESH Acetyl-coenzyme A synthetase OS=Shewanella sediminis (strain HAW-EB3) GN=acsA PE=3 SV=1 86 664 2.0E-37
sp|A6WM52|ACSA_SHEB8 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 86 657 2.0E-37
sp|A3D3E8|ACSA_SHEB5 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 86 657 2.0E-37
sp|Q9X928|ACSA_STRCO Acetyl-coenzyme A synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=acsA PE=3 SV=1 81 661 2.0E-37
sp|P16929|ACSA_NEUCR Acetyl-coenzyme A synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-5 PE=2 SV=2 23 643 4.0E-37
sp|A0KNI2|ACSA_AERHH Acetyl-coenzyme A synthetase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=acsA PE=3 SV=1 35 664 4.0E-37
sp|B0SRX5|ACSA_LEPBP Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=acsA PE=3 SV=1 14 657 6.0E-37
sp|B0S8X7|ACSA_LEPBA Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=acsA PE=3 SV=1 14 657 6.0E-37
sp|Q46Z41|ACSA_CUPPJ Acetyl-coenzyme A synthetase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=acsA PE=3 SV=1 86 657 6.0E-37
sp|Q3SLF4|ACSA_THIDA Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 86 657 7.0E-37
sp|A9KY56|ACSA_SHEB9 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS195) GN=acsA PE=3 SV=1 86 657 7.0E-37
sp|Q750T7|ACS2_ASHGO Acetyl-coenzyme A synthetase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS2 PE=3 SV=1 85 657 9.0E-37
sp|Q12MK0|ACSA_SHEDO Acetyl-coenzyme A synthetase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=acsA PE=3 SV=1 86 657 1.0E-36
sp|Q96VC7|ACS2_ZYGBA Acetyl-coenzyme A synthetase 2 OS=Zygosaccharomyces bailii GN=ACS2 PE=3 SV=1 36 643 1.0E-36
sp|A9IYZ3|ACSA_BART1 Acetyl-coenzyme A synthetase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=acsA PE=3 SV=1 86 657 1.0E-36
sp|Q6BQF2|ACS1_DEBHA Acetyl-coenzyme A synthetase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS1 PE=3 SV=1 82 651 1.0E-36
sp|Q2G512|ACSA_NOVAD Acetyl-coenzyme A synthetase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=acsA PE=3 SV=1 86 651 3.0E-36
sp|Q6FXI2|ACS2_CANGA Acetyl-coenzyme A synthetase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS2 PE=3 SV=1 85 652 3.0E-36
sp|Q54Z60|ACSA_DICDI Acetyl-coenzyme A synthetase OS=Dictyostelium discoideum GN=acsA PE=3 SV=1 7 665 3.0E-36
sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=acsA PE=3 SV=1 86 651 7.0E-36
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 81 661 7.0E-36
sp|O68040|ACSA_RHOCB Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 36 664 8.0E-36
sp|Q8NJN3|ACS2_CANAL Acetyl-coenzyme A synthetase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACS2 PE=3 SV=2 20 655 9.0E-36
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 85 651 1.0E-35
sp|Q6G1W0|ACSA_BARHE Acetyl-coenzyme A synthetase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=acsA PE=3 SV=1 86 657 1.0E-35
sp|Q8FYQ3|ACSA_BRUSU Acetyl-coenzyme A synthetase OS=Brucella suis biovar 1 (strain 1330) GN=acsA PE=3 SV=1 86 651 1.0E-35
sp|A9M849|ACSA_BRUC2 Acetyl-coenzyme A synthetase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=acsA PE=3 SV=1 86 651 1.0E-35
sp|Q57B76|ACSA_BRUAB Acetyl-coenzyme A synthetase OS=Brucella abortus biovar 1 (strain 9-941) GN=acsA PE=3 SV=1 86 651 1.0E-35
sp|Q2YLH5|ACSA_BRUA2 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain 2308) GN=acsA PE=3 SV=1 86 651 1.0E-35
sp|B2S7N5|ACSA_BRUA1 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain S19) GN=acsA PE=3 SV=1 86 651 1.0E-35
sp|A9WWT6|ACSA_BRUSI Acetyl-coenzyme A synthetase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=acsA PE=3 SV=1 86 651 1.0E-35
sp|Q21LV0|ACSA_SACD2 Acetyl-coenzyme A synthetase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=acsA PE=3 SV=1 85 651 1.0E-35
sp|Q1LL27|ACSA_CUPMC Acetyl-coenzyme A synthetase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=acsA PE=3 SV=1 86 657 1.0E-35
sp|Q6FLU2|ACS1_CANGA Acetyl-coenzyme A synthetase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS1 PE=3 SV=1 33 657 2.0E-35
sp|C0RF62|ACSA_BRUMB Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=acsA PE=3 SV=1 86 638 2.0E-35
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 33 657 3.0E-35
sp|Q9NR19|ACSA_HUMAN Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens GN=ACSS2 PE=1 SV=1 33 657 4.0E-35
sp|A4G3L8|ACSA_HERAR Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 86 657 4.0E-35
sp|Q8YJ48|ACSA_BRUME Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=acsA PE=3 SV=2 86 638 5.0E-35
sp|Q6MNF1|ACSA_BDEBA Acetyl-coenzyme A synthetase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=acsA PE=3 SV=1 29 657 5.0E-35
sp|Q6FYL4|ACSA_BARQU Acetyl-coenzyme A synthetase OS=Bartonella quintana (strain Toulouse) GN=acsA PE=3 SV=1 86 651 5.0E-35
sp|Q9RRL7|ACSA_DEIRA Acetyl-coenzyme A synthetase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=acsA PE=3 SV=1 86 657 6.0E-35
sp|B5ZV36|ACSA_RHILW Acetyl-coenzyme A synthetase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=acsA PE=3 SV=1 86 651 7.0E-35
sp|Q9KWA3|ACSA_AGRRH Acetyl-coenzyme A synthetase OS=Agrobacterium rhizogenes GN=acsA PE=3 SV=1 86 651 8.0E-35
sp|P16928|ACSA_EMENI Acetyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=facA PE=2 SV=2 85 651 1.0E-34
sp|B3PS41|ACSA_RHIE6 Acetyl-coenzyme A synthetase OS=Rhizobium etli (strain CIAT 652) GN=acsA PE=3 SV=1 86 651 1.0E-34
sp|B8EPJ0|ACSA_METSB Acetyl-coenzyme A synthetase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=acsA PE=3 SV=1 86 651 1.0E-34
sp|Q84P17|AEE18_ARATH Probable acyl-activating enzyme 18, peroxisomal OS=Arabidopsis thaliana GN=AAE18 PE=2 SV=1 2 627 1.0E-34
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 33 657 1.0E-34
sp|A1UR36|ACSA_BARBK Acetyl-coenzyme A synthetase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=acsA PE=3 SV=1 86 651 2.0E-34
sp|Q9QXG4|ACSA_MOUSE Acetyl-coenzyme A synthetase, cytoplasmic OS=Mus musculus GN=Acss2 PE=1 SV=2 33 657 3.0E-34
sp|Q2K2T1|ACSA_RHIEC Acetyl-coenzyme A synthetase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=acsA PE=3 SV=1 86 651 3.0E-34
sp|Q27549|ACSA_CRYPV Acetyl-coenzyme A synthetase OS=Cryptosporidium parvum GN=ACS PE=3 SV=1 37 658 4.0E-34
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 81 658 4.0E-34
sp|P28812|Y3568_PSEAE Uncharacterized protein PA3568 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3568 PE=3 SV=2 86 661 4.0E-34
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 36 651 4.0E-34
sp|A8FNJ7|ACSA_CAMJ8 Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=acsA PE=3 SV=1 86 660 5.0E-34
sp|A6WXV8|ACSA_OCHA4 Acetyl-coenzyme A synthetase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=acsA PE=3 SV=1 86 651 6.0E-34
sp|A1W1D6|ACSA_CAMJJ Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=acsA PE=3 SV=1 86 563 1.0E-33
sp|Q9PMD2|ACSA_CAMJE Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=acsA PE=3 SV=1 86 563 1.0E-33
sp|Q9VP61|ACSA_DROME Acetyl-coenzyme A synthetase OS=Drosophila melanogaster GN=AcCoAS PE=2 SV=1 86 650 2.0E-33
sp|A6UED8|ACSA_SINMW Acetyl-coenzyme A synthetase OS=Sinorhizobium medicae (strain WSM419) GN=acsA PE=3 SV=1 86 651 4.0E-33
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 86 638 4.0E-33
sp|C3MAS0|ACSA_RHISN Acetyl-coenzyme A synthetase OS=Rhizobium sp. (strain NGR234) GN=acsA PE=3 SV=1 86 651 5.0E-33
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 1 642 8.0E-33
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 86 651 8.0E-33
sp|P52910|ACS2_YEAST Acetyl-coenzyme A synthetase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS2 PE=1 SV=1 85 652 9.0E-33
sp|Q8UBV5|ACSA_AGRFC Acetyl-coenzyme A synthetase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=acsA PE=3 SV=2 78 651 1.0E-32
sp|Q92KX2|ACSA_RHIME Acetyl-coenzyme A synthetase OS=Rhizobium meliloti (strain 1021) GN=acsA1 PE=3 SV=1 86 651 4.0E-32
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 86 657 5.0E-32
sp|B9DGD6|ACS_ARATH Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal OS=Arabidopsis thaliana GN=ACS PE=1 SV=1 38 657 6.0E-32
sp|B9JEV4|ACSA_AGRRK Acetyl-coenzyme A synthetase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=acsA PE=3 SV=1 86 651 8.0E-32
sp|Q1QEB6|ACSA_PSYCK Acetyl-coenzyme A synthetase OS=Psychrobacter cryohalolentis (strain K5) GN=acsA PE=3 SV=1 35 639 4.0E-31
sp|Q4FVA1|ACSA_PSYA2 Acetyl-coenzyme A synthetase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=acsA PE=3 SV=1 51 639 6.0E-31
sp|B9JV43|ACSA_AGRVS Acetyl-coenzyme A synthetase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=acsA PE=3 SV=1 78 651 1.0E-30
sp|Q9Y7B5|ACS2_KLULA Acetyl-coenzyme A synthetase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS2 PE=3 SV=2 85 652 2.0E-30
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 86 651 4.0E-30
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 86 651 5.0E-30
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 86 651 5.0E-30
sp|P77495|PRPE_ECOLI Propionate--CoA ligase OS=Escherichia coli (strain K12) GN=prpE PE=3 SV=1 81 654 2.0E-28
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 81 642 3.0E-27
sp|Q554Z5|ACSB_DICDI Acyl-CoA synthetase short-chain family member B, mitochondrial OS=Dictyostelium discoideum GN=aslB PE=3 SV=1 84 663 5.0E-27
sp|P55912|PRPE_SALTY Propionate--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpE PE=3 SV=2 81 655 9.0E-27
sp|Q9H6R3|ACSS3_HUMAN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens GN=ACSS3 PE=1 SV=1 86 651 2.0E-24
sp|Q5REB8|ACSS3_PONAB Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Pongo abelii GN=ACSS3 PE=2 SV=1 85 651 2.0E-24
sp|Q93LL2|ACSA_NOSLI Acetyl-coenzyme A synthetase (Fragment) OS=Nostoc linckia GN=acsA PE=3 SV=1 86 411 1.0E-23
sp|F4KBF3|AAE17_ARATH Probable acyl-activating enzyme 17, peroxisomal OS=Arabidopsis thaliana GN=AAE17 PE=2 SV=1 53 643 9.0E-23
sp|Q14DH7|ACSS3_MOUSE Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Mus musculus GN=Acss3 PE=1 SV=2 75 665 2.0E-22
sp|A7MB45|ACSS3_BOVIN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Bos taurus GN=ACSS3 PE=2 SV=1 85 664 7.0E-22
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 113 627 4.0E-17
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 115 627 5.0E-17
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 85 634 1.0E-16
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 115 627 2.0E-16
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 92 627 7.0E-16
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 90 627 1.0E-15
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 115 627 1.0E-14
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 90 627 1.0E-14
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 115 627 8.0E-14
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 115 627 1.0E-13
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 82 627 1.0E-13
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 115 627 1.0E-12
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 121 627 2.0E-12
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 115 627 2.0E-12
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 120 627 3.0E-12
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 121 627 5.0E-12
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 90 627 1.0E-11
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 90 627 1.0E-11
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 115 627 3.0E-11
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 88 627 6.0E-11
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 87 627 2.0E-10
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 87 627 2.0E-10
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 121 657 6.0E-10
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 115 627 2.0E-09
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 121 496 6.0E-09
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 121 633 7.0E-09
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 121 627 4.0E-08
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 121 563 1.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 121 627 5.0E-07
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 121 410 5.0E-07
sp|Q00594|ALKK_PSEOL Medium-chain-fatty-acid--CoA ligase OS=Pseudomonas oleovorans GN=alkK PE=3 SV=1 115 649 2.0E-06
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 276 649 4.0E-06
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 121 627 4.0E-06
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 87 627 7.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup7251
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|042120 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|042120

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|042120
MDSYFSQSKLLWTPRNPEFTSTDLFRRLINRKHGLNLQDFHELHKYSVEHDEFWLDLWEFLGIISSIPPNKDRIT
VPGKIPEIPTWFPDARLNYAENLLWRRDDAIAITATGELGNVEHYTFRQLWQMVRKMASALRTSGLQVGDRVAAI
VTNSINSVVIAIAVASIGGIFSTTATDMGTQGILDRYRQIRPKFVFSDTEVSYAGKQIDLSDKIKEVVGDLSTYG
LQQTILLPSRISGKEIEMDNLRNSVSLARFLQAADEHELVFEQLPFNQPLFILYSSGTSGKPKCIVHSAGGVLLQ
TKKSVHFGPNLSMNDTMFQYTTTGWMMWTYMLVGLALGARIILYDGSPFYPDLINYLKFIDTQNVTLLGTSPRFL
AEIQGRGISPLKIGKFDALKTITCTGAVLTTPMFEWTQNAFGKNVHVVSTSGGTDVCTAFVTGNPTLPVYAGEIQ
CKDLGQKVEVFDQDGNNIEHTGQPGELVCTKSHPSLPLFFWGDESGMKLRETYFDMYPGIWRQGDFMIINPKTKG
ILILGRSDGVLNPSGVRFGSGEIYNVLEQFSSVIDDSLCVGQRRSQDKDERVLLFLKMRQGQKFTAQLQTQIRSV
IKTALSARHVPAYIFEIEDIPYTVNGKKIEIAVKQIVSGSNLQPSGTVANPDSLKLLDFELTKSIGIFGIPERSR
RIRC*
Coding >AgabiH39|042120
ATGGACTCTTATTTCTCTCAGTCAAAACTCTTGTGGACTCCTCGAAACCCCGAATTCACGAGTACCGACTTGTTT
CGTCGCCTCATCAACAGAAAACATGGGCTCAACCTTCAGGATTTTCATGAGCTGCACAAGTACTCTGTTGAACAC
GACGAATTTTGGCTAGACCTCTGGGAATTTCTTGGCATCATCAGCTCTATACCTCCCAATAAGGATCGTATCACC
GTGCCAGGAAAGATCCCAGAAATACCTACTTGGTTTCCAGATGCCAGGTTAAATTATGCCGAAAATCTTCTGTGG
CGTAGAGACGACGCAATAGCAATCACTGCCACTGGAGAACTGGGAAATGTTGAACATTACACATTCAGACAGCTG
TGGCAAATGGTCAGGAAGATGGCCTCAGCGCTTAGAACGTCAGGACTCCAGGTCGGGGATAGAGTAGCTGCTATC
GTTACGAACTCGATCAATTCCGTGGTTATCGCCATCGCGGTAGCGAGCATCGGTGGAATATTCTCTACCACGGCG
ACAGACATGGGTACACAGGGCATACTAGACAGATACCGTCAAATCCGCCCTAAATTCGTCTTTTCAGATACAGAA
GTTTCCTATGCTGGCAAACAGATAGACCTCTCAGATAAGATCAAAGAGGTTGTGGGAGATCTCAGCACATATGGT
CTCCAGCAGACCATTCTCTTACCGAGTCGTATATCTGGAAAGGAAATTGAGATGGATAATCTCCGCAACAGCGTA
AGCCTCGCCAGATTTTTGCAGGCCGCTGATGAACACGAGCTAGTGTTCGAACAATTACCTTTCAACCAGCCCTTG
TTCATTCTCTATAGCTCGGGAACTTCTGGAAAACCAAAGTGTATTGTACACTCCGCTGGGGGCGTTTTGTTGCAA
ACTAAGAAAAGCGTTCACTTTGGTCCCAACCTCAGTATGAATGATACTATGTTCCAGTACACAACCACAGGATGG
ATGATGTGGACCTACATGCTGGTTGGTCTTGCTCTTGGCGCTCGTATCATTCTATATGATGGCTCTCCTTTCTAT
CCCGACCTTATCAACTACTTGAAATTCATTGATACCCAAAACGTGACACTCCTAGGCACTAGTCCACGTTTCCTC
GCTGAAATTCAAGGCCGCGGCATCTCGCCTCTCAAGATAGGTAAATTTGATGCATTGAAGACAATCACCTGTACC
GGGGCCGTCCTTACGACACCCATGTTCGAATGGACACAAAATGCTTTCGGAAAGAATGTACATGTAGTTTCGACG
AGTGGTGGTACGGATGTGTGTACGGCGTTTGTGACCGGAAACCCAACGCTACCTGTATACGCAGGAGAGATCCAG
TGTAAGGATCTAGGACAAAAAGTTGAGGTATTTGACCAGGATGGCAATAATATCGAACACACAGGCCAGCCGGGA
GAGTTGGTTTGCACAAAGTCCCATCCTTCCTTACCACTTTTCTTCTGGGGAGATGAATCCGGAATGAAACTACGT
GAGACCTACTTTGATATGTATCCCGGTATCTGGAGGCAGGGTGATTTCATGATCATTAATCCCAAGACAAAGGGA
ATTTTAATCCTTGGCCGAAGCGACGGTGTTCTAAACCCAAGCGGTGTACGATTCGGATCTGGAGAAATTTACAAT
GTCCTTGAGCAGTTTTCATCCGTCATCGATGATTCGCTCTGCGTTGGTCAAAGACGTTCTCAGGACAAAGACGAA
CGCGTTCTTCTATTCTTGAAGATGCGTCAGGGCCAAAAATTTACAGCGCAATTACAAACCCAGATTCGGAGTGTT
ATAAAGACCGCGCTAAGTGCCAGGCACGTACCGGCTTACATTTTTGAAATTGAAGACATTCCTTACACGGTTAAT
GGGAAAAAAATTGAAATAGCTGTCAAACAAATTGTTTCCGGGTCCAACTTACAGCCTAGTGGAACAGTTGCGAAC
CCAGATTCGTTGAAACTGCTAGACTTTGAACTCACGAAGTCAATTGGTATCTTCGGGATTCCCGAGCGTTCTAGA
CGGATCCGTTGCTAG
Transcript >AgabiH39|042120
ATGGACTCTTATTTCTCTCAGTCAAAACTCTTGTGGACTCCTCGAAACCCCGAATTCACGAGTACCGACTTGTTT
CGTCGCCTCATCAACAGAAAACATGGGCTCAACCTTCAGGATTTTCATGAGCTGCACAAGTACTCTGTTGAACAC
GACGAATTTTGGCTAGACCTCTGGGAATTTCTTGGCATCATCAGCTCTATACCTCCCAATAAGGATCGTATCACC
GTGCCAGGAAAGATCCCAGAAATACCTACTTGGTTTCCAGATGCCAGGTTAAATTATGCCGAAAATCTTCTGTGG
CGTAGAGACGACGCAATAGCAATCACTGCCACTGGAGAACTGGGAAATGTTGAACATTACACATTCAGACAGCTG
TGGCAAATGGTCAGGAAGATGGCCTCAGCGCTTAGAACGTCAGGACTCCAGGTCGGGGATAGAGTAGCTGCTATC
GTTACGAACTCGATCAATTCCGTGGTTATCGCCATCGCGGTAGCGAGCATCGGTGGAATATTCTCTACCACGGCG
ACAGACATGGGTACACAGGGCATACTAGACAGATACCGTCAAATCCGCCCTAAATTCGTCTTTTCAGATACAGAA
GTTTCCTATGCTGGCAAACAGATAGACCTCTCAGATAAGATCAAAGAGGTTGTGGGAGATCTCAGCACATATGGT
CTCCAGCAGACCATTCTCTTACCGAGTCGTATATCTGGAAAGGAAATTGAGATGGATAATCTCCGCAACAGCGTA
AGCCTCGCCAGATTTTTGCAGGCCGCTGATGAACACGAGCTAGTGTTCGAACAATTACCTTTCAACCAGCCCTTG
TTCATTCTCTATAGCTCGGGAACTTCTGGAAAACCAAAGTGTATTGTACACTCCGCTGGGGGCGTTTTGTTGCAA
ACTAAGAAAAGCGTTCACTTTGGTCCCAACCTCAGTATGAATGATACTATGTTCCAGTACACAACCACAGGATGG
ATGATGTGGACCTACATGCTGGTTGGTCTTGCTCTTGGCGCTCGTATCATTCTATATGATGGCTCTCCTTTCTAT
CCCGACCTTATCAACTACTTGAAATTCATTGATACCCAAAACGTGACACTCCTAGGCACTAGTCCACGTTTCCTC
GCTGAAATTCAAGGCCGCGGCATCTCGCCTCTCAAGATAGGTAAATTTGATGCATTGAAGACAATCACCTGTACC
GGGGCCGTCCTTACGACACCCATGTTCGAATGGACACAAAATGCTTTCGGAAAGAATGTACATGTAGTTTCGACG
AGTGGTGGTACGGATGTGTGTACGGCGTTTGTGACCGGAAACCCAACGCTACCTGTATACGCAGGAGAGATCCAG
TGTAAGGATCTAGGACAAAAAGTTGAGGTATTTGACCAGGATGGCAATAATATCGAACACACAGGCCAGCCGGGA
GAGTTGGTTTGCACAAAGTCCCATCCTTCCTTACCACTTTTCTTCTGGGGAGATGAATCCGGAATGAAACTACGT
GAGACCTACTTTGATATGTATCCCGGTATCTGGAGGCAGGGTGATTTCATGATCATTAATCCCAAGACAAAGGGA
ATTTTAATCCTTGGCCGAAGCGACGGTGTTCTAAACCCAAGCGGTGTACGATTCGGATCTGGAGAAATTTACAAT
GTCCTTGAGCAGTTTTCATCCGTCATCGATGATTCGCTCTGCGTTGGTCAAAGACGTTCTCAGGACAAAGACGAA
CGCGTTCTTCTATTCTTGAAGATGCGTCAGGGCCAAAAATTTACAGCGCAATTACAAACCCAGATTCGGAGTGTT
ATAAAGACCGCGCTAAGTGCCAGGCACGTACCGGCTTACATTTTTGAAATTGAAGACATTCCTTACACGGTTAAT
GGGAAAAAAATTGAAATAGCTGTCAAACAAATTGTTTCCGGGTCCAACTTACAGCCTAGTGGAACAGTTGCGAAC
CCAGATTCGTTGAAACTGCTAGACTTTGAACTCACGAAGTCAATTGGTATCTTCGGGATTCCCGAGCGTTCTAGA
CGGATCCGTTGCTAG
Gene >AgabiH39|042120
ATGGACTCTTATTTCTCTCAGTCAAAACTCTTGTGGACTCCTCGAAACCCCGAATTCACGAGTACCGACTTGTTT
CGTCGCCTCATCAACAGAAAACATGGGCTCAACCTTCGTGAGTATTTTCATTTGCTTACATGACGTTTTCATCAT
TGAAGGAATCGAAACCTTAGAGGATTTTCATGAGCTGCACAAGTACTCTGTTGAACACGACGAATTTTGGCTAGA
CCTCTGGGAATTTCTTGGCATCATCAGCTCTATACCTCCCAATAAGGTGCGGCTCATGATAAAAGTCATGCAGCT
CTTTTGACAATGGAAGACACTTACAGGATCGTATCACCGTGCCAGGAAAGATCCCAGAAATACCTACTTGGTTTC
CAGATGCCAGGTTAAATTATGCCGAAAATCTTCTGTGGCGTAGAGACGACGCAATAGCAATCACTGCCACTGGAG
AACTGGGAAATGTTGAACATTACACATTCAGACAGCTGTGGCAAATGGTCAGGAAGATGGCCTCAGCGCTTAGAA
CGTCAGGACTCCAGGTCGGGGATAGAGTAGCTGGTGTGTTTAGCAGTTGAGATGGTGTCTCGTTTGCCATGCTCA
CTCTAGGTATAGCTATCGTTACGAACTCGATCAATTCCGTGGTTATCGCCATCGCGGTAGCGAGCATCGGTGGAA
TATTCTCTACCACGGCGACAGACATGGGTACACAGGTGAGCATACAGTCTCTGTCCTTGACATCTTTTCTAATCT
AATCACGGCAGGGCATACTAGACAGATACCGTCAAATCCGCCCTAAATTCGTCTTTTCAGATACAGAAGTTTCCT
ATGCTGGCAAACAGATAGACCTCTCAGATAAGATCAAAGAGGTTGTGGGAGATCTCAGCACATATGGTCTCCAGC
AGACCATTCTCTTACCGAGTCGTATATCTGGAAAGGAAATTGAGATGGATAATCTCCGCAACAGGTGGGTTTTGA
TGTCGCACGGGAGATGTTTAAATCATTTACAATCTATGATATTACCTAGCGTAAGCCTCGCCAGATTTTTGCAGG
CCGCTGATGAACACGAGCTAGTGTTCGAACAATTACCTTTCAACCAGCCCTTGTTCATTCTCTATAGCTCGGGAA
CTTCTGGAAAACCAAAGTGTATTGTACACTCCGCTGGGGTAAATGCAGTTATTTTCTGGTACATCTTAGAAAAGA
TGCTGATCCCGGGAAAAGGGCGTTTTGTTGCAAACTAAGAAAAGCGTTCACTTTGGTCCCAACCTCAGTATGAAT
GATACTATGTTCCAGTACACAACCGTACGTCATTCTCTATAATCATGCCGTTTGGCTGCTGCTGAGATTCGTATT
TATAGACAGGATGGATGATGTGGACCTACATGCTGGTTGGTCTTGCTCTTGGCGCTCGTATCATTCTATATGATG
GCTCTCCTTTCTATCCCGACCTTATCAACTACTTGAAATTCATTGATACCCAAAAGTCAGTCAATTCTATGTCCG
AGCTGCGTTATATTAAACTTGGTTAGCGTGACACTCCTAGGCACTAGTCCACGTTTCCTCGCTGAAATTCAAGGC
CGCGGCATCTCGCCTCGTATGTCTCCAATTCTTCATCATCGTTATTCGGGTGACTTAAAAAAGGGACAAACAGTC
AAGATAGGTAAATTTGATGCATTGAAGACAATCACCTGTACCGGGGCCGTCCTTACGACACCCATGTTCGAATGG
ACACAAAATGCTTTCGGAAAGAATGTACATGTAGTTTCGACGAGTGGTGGTACGGATGTGTGTACGGCGTGTATG
TCTGCTGCAGTTTCGCTATATCGAATTAAGTTTGACCTTTCTACCAAGTTGTGACCGGAAACCCAACGCTACCTG
TATACGCAGGAGGTGAGTACCATGTAGCATCCTCATGGGGAATTAATTAATGATGGCATACAGAGATCCAGTGTA
AGGATCTAGGACAAAAAGTTGAGGTATTTGACCAGGATGGCAATAATATCGAACACACAGGCCAGCCGGGAGAGT
TGGTTTGCACAAAGTCCCATCCTTCCTTACCACTTTTCTTCTGGGGAGATGAATCCGGAATGAAACTACGTGAGA
CCTACTTTGATATGTATCCCGGTAAGTCAAGTATATTGAGGGGTTAGAAATCCTGTGCTCAATTTTGCAGGTATC
TGGAGGCAGGGTGATTTCATGATCATTAATCCCAAGACAAAGGGAATTTTAATCCTTGGCCGAAGGTAGTGTGGC
CACCGCTAGTCGCTTCTGACATCTCACTTTCTTCCCAGCGACGGTGTTCTAAACCCAAGCGGTGTACGATTCGGA
TCTGGAGAAATTTACAATGTCCTTGAGCAGTTTTCATCCGTCATCGATGATTCGCTCTGCGTTGGTCAAAGACGT
TCTCAGGACAAAGACGAACGCGTTCTTCTATTCTTGAAGATGCGTCAGGGCCAAAAATTTACAGCGCAATTACAA
ACCCAGATTCGGAGTGTTATAAAGACCGCGCTAAGTGCCAGGCACGTACCGGCTTACATTTTTGAAATTGAAGAC
ATTCCTGTGAGTGTACTTGGCATTTCTTCAAACATCTCTGAATCGAATTGCTATTCTTGATGAACCGAACAGTAC
ACGGTTAATGGGAAAAAAATTGAAATAGCTGTCAAACAAATTGTTTCCGGGTCCAACTTACAGCCTAGTGGAACA
GTTGCGAACCCAGATTCGTTGAAACTGTATTACAGATTCAGGGATGTTGAAGCAGTGACACATGCTGTCAAGGCT
AGACTTTGAACTCACGAAGTCAATTGGTATCTTCGGTGCGCTTTTTTCCGCTATCGAATTTTGATGAGGTACCCA
CACCGTCGATTACCTCTTATTAATTTGTACAGGGATTCCCGAGCGTTCTAGACGGATCCGTTGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail