Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|040580
Gene name
Locationscaffold_02:473019..473725
Strand-
Gene length (bp)706
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 79 98 19
3 103 125 22
4 151 173 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1268
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|040580 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|040580
Rhodonia placenta FPRL280 RhoplFPRL280|10_103

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|040580
MASPALPGVFFCFAAMVLLIFVSVSAPTWEAISFLNVGPEGHQVHYGVFGFTGSQRSIGYTFSNNSRLNTTVLHN
LTKVLILHPIVAGMSGLAFILGLSHARIGTVFMALVAGLAALVTFVVWVIDLVLFGIARHHFRDDGQLAQYGNAN
WLTLGALVALLLGFCVSACGMFGRYRKRRNVY*
Coding >AgabiH39|040580
ATGGCTTCACCAGCTCTGCCAGGAGTGTTCTTTTGCTTTGCAGCAATGGTCCTTCTAATATTTGTTAGTGTATCT
GCTCCCACATGGGAGGCAATATCATTCTTGAATGTCGGCCCCGAAGGCCATCAAGTCCACTACGGTGTCTTTGGA
TTTACTGGTTCTCAGCGTTCGATAGGATACACCTTTAGTAACAACAGTCGGTTGAATACGACGGTTCTGCACAAT
CTTACCAAGGTATTGATTCTCCACCCAATTGTTGCCGGCATGTCAGGATTGGCATTCATTCTTGGCCTCTCCCAT
GCCCGTATCGGCACTGTGTTCATGGCCCTCGTCGCGGGTCTTGCTGCACTGGTAACGTTTGTCGTATGGGTCATT
GATTTAGTTCTCTTCGGTATCGCCCGCCACCACTTCCGCGATGATGGTCAGCTGGCGCAATATGGCAATGCCAAC
TGGCTTACTCTGGGTGCCCTTGTCGCCCTCTTGCTTGGCTTCTGTGTATCTGCTTGTGGCATGTTTGGGCGATAC
AGGAAACGGAGGAATGTGTATTGA
Transcript >AgabiH39|040580
ATGGCTTCACCAGCTCTGCCAGGAGTGTTCTTTTGCTTTGCAGCAATGGTCCTTCTAATATTTGTTAGTGTATCT
GCTCCCACATGGGAGGCAATATCATTCTTGAATGTCGGCCCCGAAGGCCATCAAGTCCACTACGGTGTCTTTGGA
TTTACTGGTTCTCAGCGTTCGATAGGATACACCTTTAGTAACAACAGTCGGTTGAATACGACGGTTCTGCACAAT
CTTACCAAGGTATTGATTCTCCACCCAATTGTTGCCGGCATGTCAGGATTGGCATTCATTCTTGGCCTCTCCCAT
GCCCGTATCGGCACTGTGTTCATGGCCCTCGTCGCGGGTCTTGCTGCACTGGTAACGTTTGTCGTATGGGTCATT
GATTTAGTTCTCTTCGGTATCGCCCGCCACCACTTCCGCGATGATGGTCAGCTGGCGCAATATGGCAATGCCAAC
TGGCTTACTCTGGGTGCCCTTGTCGCCCTCTTGCTTGGCTTCTGTGTATCTGCTTGTGGCATGTTTGGGCGATAC
AGGAAACGGAGGAATGTGTATTGA
Gene >AgabiH39|040580
ATGGCTTCACCAGCTCTGCCAGGAGTGTTCTTTTGCTTTGCAGCAATGGTCCTTCTAATATTTGTATGTTGATAC
ATTCCAAATCATCTCGATCTTAGTACCCATTGGATGATTTCCAGGTTAGTGTATCTGCTCCCACATGGGAGGCAA
TATCATTCTTGAATGTCGGCCCCGAAGGCCATCAAGTCCACTACGGTGTCTTTGGATTTACTGGTTCTCAGCGTT
CGATAGGATACACCTTTAGGTACTAGTTGATATTCCTATGAGATCGTCTTTCTAACATTTCATTAGTAACAACAG
TCGGTTGAATACGACGGTTCTGCACAATCTTACCAAGGTATTGATTCTCCACCCAATTGGTAAGTGCAGAATTGC
GTGGCCATGTTCTTCATTTCTAACTTACCCTCGCGCAGTTGCCGGCATGTCAGGATTGGCATTCATTCTTGGCCT
CTCCCATGCCCGTATCGGCACTGTGTTCATGGCCCTCGTCGCGGGTCTTGCTGCACTGGTAACGTTTGTCGTATG
GGTCATTGATTTAGTTCTCTTCGGTATCGCCCGCCACCACTTCCGCGATGATGGTCAGCTGGCGCAATATGGCAA
TGCCAACTGGCTTACTCTGGGTGCCCTTGTCGCCCTCTTGCTTGGCTTCTGTGTATCTGCTTGTGGCATGTTTGG
GCGATACAGGAAACGGAGGAATGTGTATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail