Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|038860
Gene name
Locationscaffold_02:107447..109102
Strand+
Gene length (bp)1655
Transcript length (bp)1500
Coding sequence length (bp)1500
Protein length (aa) 500

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1266
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|038860 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|038870
Agaricus bisporus var bisporus H39 AgabiH39|038890
Agaricus bisporus var bisporus H39 AgabiH39|038930
Agaricus bisporus var bisporus H39 AgabiH39|039040
Agaricus bisporus var bisporus H39 AgabiH39|238500
Agaricus bisporus var bisporus H39 AgabiH39|295900
Agaricus bisporus var bisporus H97 AgabiH97|038930
Agaricus bisporus var bisporus H97 AgabiH97|038920
Agaricus bisporus var bisporus H97 AgabiH97|038910
Agaricus bisporus var bisporus H97 AgabiH97|038900
Agaricus bisporus var bisporus H97 AgabiH97|038860
Agaricus bisporus var bisporus H97 AgabiH97|038870
Agaricus bisporus var bisporus H97 AgabiH97|039040
Agaricus bisporus var bisporus H97 AgabiH97|038850
Agaricus bisporus var bisporus H97 AgabiH97|038890
Agaricus bisporus var bisporus H97 AgabiH97|063380

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|038860
MLMTCQTAEGSKTGFSLLPPELVVEVFKRLHWRDLLKARQTCALFYSISKSRDIWENLIQIHAAATHGPPTTLEK
PMRMYTAGKLEEHFLRGAKNESEWLDEVRFEERSIPSPHKFRHCHLLRGGRWFLCSAVGGEMLYCDLESPGSGLV
PLIPYPFPHPCDSITSMAIEEDNEAEILCFNIALVHILEEDWLYRSSGETAVTGESWVDVWFGKVVLDEDGNATH
LHAEKLASVPLPVYLGKPILGASLRGSLLAFTVEWKSLDGFGMQCDAIILDWKAPPRTKHQLCIRKTVHFSITWA
SGVKTELMLLPGDHLLTVIRSMIRIYDHSLVPWASERRHWREALSLSEQCAHVINILPPFGPVPRDFSPIFPLSG
DRYRVVFNCFRGIRGLTLQYKDGGLFKATLVDLLEWPRTIDAFIEDRQSHFLYNYGVTLGSYDSLFRSHFTWPDE
EGSSPNRLSAITGNLSCLPAVMNMDVNTGRVLWISNRGELKEASFTAPS*
Coding >AgabiH39|038860
ATGTTAATGACTTGCCAAACAGCTGAAGGTTCGAAGACTGGGTTCAGCTTGCTACCGCCTGAGCTTGTTGTTGAA
GTATTCAAACGATTACATTGGAGAGACCTACTGAAGGCGCGCCAAACCTGTGCGCTCTTTTACAGTATTTCTAAA
TCTAGGGATATATGGGAGAACTTGATTCAAATTCACGCTGCTGCCACGCATGGACCCCCGACAACGTTGGAAAAA
CCTATGCGTATGTATACCGCTGGAAAACTCGAAGAGCATTTCCTTCGTGGTGCGAAAAATGAGTCCGAGTGGCTG
GACGAGGTTCGGTTTGAAGAACGGAGTATTCCATCTCCTCACAAGTTCAGGCATTGTCATCTCCTTCGAGGCGGA
CGGTGGTTCCTCTGCTCCGCCGTTGGAGGCGAGATGCTTTATTGTGACCTCGAATCGCCTGGATCTGGATTAGTT
CCCTTAATCCCATATCCATTCCCACACCCATGCGACTCTATCACTTCAATGGCTATCGAAGAAGACAACGAGGCG
GAAATTCTATGTTTTAACATCGCTCTAGTCCATATTTTGGAGGAAGATTGGTTATATAGATCGAGTGGCGAAACG
GCGGTGACTGGAGAGTCCTGGGTTGACGTGTGGTTTGGAAAGGTCGTTTTGGATGAAGATGGGAATGCTACGCAT
TTGCACGCTGAGAAGCTTGCCTCCGTTCCCTTGCCTGTTTATCTTGGTAAACCAATATTGGGTGCATCTTTGCGC
GGCTCCCTGCTTGCTTTTACTGTTGAATGGAAATCTCTGGATGGATTTGGCATGCAATGCGACGCGATCATTTTA
GACTGGAAAGCGCCGCCAAGGACTAAACATCAACTCTGTATCCGCAAAACTGTCCATTTTTCTATCACTTGGGCT
TCTGGCGTCAAGACGGAATTGATGCTCCTCCCCGGAGATCACTTGCTTACCGTAATTCGATCAATGATCCGCATT
TATGACCACTCCTTGGTTCCATGGGCCTCAGAGCGGCGGCACTGGCGTGAGGCACTTTCGCTATCTGAGCAATGT
GCGCACGTTATCAATATACTCCCACCCTTTGGCCCCGTTCCTCGCGATTTCTCGCCAATTTTCCCCCTCTCTGGA
GATCGATATCGTGTAGTGTTCAATTGCTTTCGTGGGATAAGGGGTTTGACGTTGCAATATAAAGACGGGGGCTTA
TTCAAAGCCACTTTAGTTGACCTTTTGGAATGGCCCAGAACGATAGACGCATTCATCGAGGATCGCCAGTCCCAC
TTCTTGTATAACTATGGCGTAACTCTTGGCAGCTATGACTCTCTTTTTCGTTCTCATTTTACCTGGCCTGATGAG
GAGGGATCATCGCCAAACAGGCTCTCAGCTATCACGGGAAACCTGAGTTGCCTTCCTGCTGTCATGAATATGGAT
GTCAATACGGGAAGAGTGTTATGGATATCAAACCGCGGCGAATTGAAAGAGGCTTCGTTCACAGCGCCGTCGTAA
Transcript >AgabiH39|038860
ATGTTAATGACTTGCCAAACAGCTGAAGGTTCGAAGACTGGGTTCAGCTTGCTACCGCCTGAGCTTGTTGTTGAA
GTATTCAAACGATTACATTGGAGAGACCTACTGAAGGCGCGCCAAACCTGTGCGCTCTTTTACAGTATTTCTAAA
TCTAGGGATATATGGGAGAACTTGATTCAAATTCACGCTGCTGCCACGCATGGACCCCCGACAACGTTGGAAAAA
CCTATGCGTATGTATACCGCTGGAAAACTCGAAGAGCATTTCCTTCGTGGTGCGAAAAATGAGTCCGAGTGGCTG
GACGAGGTTCGGTTTGAAGAACGGAGTATTCCATCTCCTCACAAGTTCAGGCATTGTCATCTCCTTCGAGGCGGA
CGGTGGTTCCTCTGCTCCGCCGTTGGAGGCGAGATGCTTTATTGTGACCTCGAATCGCCTGGATCTGGATTAGTT
CCCTTAATCCCATATCCATTCCCACACCCATGCGACTCTATCACTTCAATGGCTATCGAAGAAGACAACGAGGCG
GAAATTCTATGTTTTAACATCGCTCTAGTCCATATTTTGGAGGAAGATTGGTTATATAGATCGAGTGGCGAAACG
GCGGTGACTGGAGAGTCCTGGGTTGACGTGTGGTTTGGAAAGGTCGTTTTGGATGAAGATGGGAATGCTACGCAT
TTGCACGCTGAGAAGCTTGCCTCCGTTCCCTTGCCTGTTTATCTTGGTAAACCAATATTGGGTGCATCTTTGCGC
GGCTCCCTGCTTGCTTTTACTGTTGAATGGAAATCTCTGGATGGATTTGGCATGCAATGCGACGCGATCATTTTA
GACTGGAAAGCGCCGCCAAGGACTAAACATCAACTCTGTATCCGCAAAACTGTCCATTTTTCTATCACTTGGGCT
TCTGGCGTCAAGACGGAATTGATGCTCCTCCCCGGAGATCACTTGCTTACCGTAATTCGATCAATGATCCGCATT
TATGACCACTCCTTGGTTCCATGGGCCTCAGAGCGGCGGCACTGGCGTGAGGCACTTTCGCTATCTGAGCAATGT
GCGCACGTTATCAATATACTCCCACCCTTTGGCCCCGTTCCTCGCGATTTCTCGCCAATTTTCCCCCTCTCTGGA
GATCGATATCGTGTAGTGTTCAATTGCTTTCGTGGGATAAGGGGTTTGACGTTGCAATATAAAGACGGGGGCTTA
TTCAAAGCCACTTTAGTTGACCTTTTGGAATGGCCCAGAACGATAGACGCATTCATCGAGGATCGCCAGTCCCAC
TTCTTGTATAACTATGGCGTAACTCTTGGCAGCTATGACTCTCTTTTTCGTTCTCATTTTACCTGGCCTGATGAG
GAGGGATCATCGCCAAACAGGCTCTCAGCTATCACGGGAAACCTGAGTTGCCTTCCTGCTGTCATGAATATGGAT
GTCAATACGGGAAGAGTGTTATGGATATCAAACCGCGGCGAATTGAAAGAGGCTTCGTTCACAGCGCCGTCGTAA
Gene >AgabiH39|038860
ATGTTAATGACTTGCCAAACAGCTGTGAGTCTTCGCGTAAAACAAACTCTTGTGTACTTTTTCACAAATCTACCA
GGAAGGTTCGAAGACTGGGTTCAGCTTGCTACCGCCTGAGCTTGTTGTTGAAGTATTCAAACGATTACATTGGAG
AGACCTACTGAAGGCGCGCCAAGTGAGTCTCTAACTCAGGTGTACGATTCTATATGTACGATTCTAATCCTGTAG
ACCTGTGCGCTCTTTTACAGTATTTCTAAATCTAGGGATATATGGGAGAACTTGATTCAAATTCACGCTGCTGCC
ACGCATGGACCCCCGACAACGTTGGAAAAACCTATGCGTATGTATACCGCTGGAAAACTCGAAGAGCATTTCCTT
CGTGGTGCGAAAAATGAGTCCGAGTGGCTGGACGAGGTTCGGTTTGAAGAACGGAGTATTCCATCTCCTCACAAG
TTCAGGCATTGTCATCTCCTTCGAGGCGGACGGTGGTTCCTCTGCTCCGCCGTTGGAGGCGAGATGCTTTATTGT
GACCTCGAATCGCCTGGATCTGGATTAGTTCCCTTAATCCCATATCCATTCCCACACCCATGCGACTCTATCACT
TCAATGGCTATCGAAGAAGACAACGAGGCGGAAATTCTATGTTTTAACATCGCTCTAGTCCATATTTTGGAGGAA
GATTGGTTATATAGATCGAGTGGCGAAACGGCGGTGACTGGAGAGTCCTGGGTTGACGTGTGGTTTGGAAAGGTC
GTTTTGGATGAAGATGGGAATGCTACGCATTTGCACGCTGAGAAGCTTGCCTCCGTTCCCTTGCCTGTTTATCTT
GGTAAACCAATATTGGGTGCATCTTTGCGCGGCTCCCTGCTTGCTTTTACTGTTGAATGGAAATCTCTGGATGGA
TTTGGCATGCAATGCGACGCGATCATTTTAGACTGGAAAGCGCCGCCAAGGACTAAACATCAACTCTGTATCCGC
AAAACTGTCCATTTTTCTATCACTTGGGCTTCTGGCGTCAAGGTACGCTTGTTCATTGGGTTTGTGTACTACCAT
TAAAACAGTTCTATTAGACGGAATTGATGCTCCTCCCCGGAGATCACTTGCTTACCGTAATTCGATCAATGATCC
GCATTTATGACCACTCCTTGGTTCCATGGGCCTCAGAGCGGCGGCACTGGCGTGAGGCACTTTCGCTATCTGAGC
AATGTGCGCACGTTATCAATATACTCCCACCCTTTGGCCCCGTTCCTCGCGATTTCTCGCCAATTTTCCCCCTCT
CTGGAGATCGATATCGTGTAGTGTTCAATTGCTTTCGTGGGATAAGGGGTTTGACGTTGCAATATAAAGACGGGG
GCTTATTCAAAGCCACTTTAGTTGACCTTTTGGAATGGCCCAGAACGATAGACGCATTCATCGAGGATCGCCAGT
CCCACTTCTTGTATAACTATGGCGTAACTCTTGGCAGCTATGACTCTCTTTTTCGTTCTCATTTTACCTGGCCTG
ATGAGGAGGGATCATCGCCAAACAGGCTCTCAGCTATCACGGGAAACCTGAGTTGCCTTCCTGCTGTCATGAATA
TGGATGTCAATACGGGAAGAGTGTTATGGATATCAAACCGCGGCGAATTGAAAGAGGCTTCGTTCACAGCGCCGT
CGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail