Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|038030
Gene name
Locationscaffold_13:1249356..1251192
Strand-
Gene length (bp)1836
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 2.9E-18 34 418

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 284 492 7.0E-09

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1031
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|038030 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|038030
Rhodonia placenta FPRL280 RhoplFPRL280|1_6
Rhodonia placenta FPRL280 RhoplFPRL280|1_7
Rhodonia placenta FPRL280 RhoplFPRL280|109_6
Rhodonia placenta FPRL280 RhoplFPRL280|70_5

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|038030
MIKTHLTVLEDVASKSARSAAFRIPELDTSSNRVKSWTTITYEEFYRDVETFAKYWTQILGSNNIPQRSIIGVWL
SGFLYTDVLHIYGLSRAGYVPQLFSIRLPNPIVIYELMRRAGASALVHDTSFSSILGDSPYFTHAAEDVRRLDLQ
HLRLRPLPDVTSEDLAFVFHTSGSTSGSPKLVRANYRWLSSALEKSHHLCYPCSPQRQDVTVFMGSMCHIAQNFM
FLGTLQHGACTVQPTVLKYSPEELKDMVTRCGLNRLNQFASFLGNQLRASRQDSRLLSMLISLDDVVYSGLPLPR
EEEQYAYKHGIKIRNLFGSTEVGAMLLSGGCERNLSLVAPLPGTSYRFVPTASKSEQNQSAHRSNAELFELVILS
ESPDCPDVSLRHADGHFHTGDLFQEVMSGFYLYRGRDDDWIKSENSLRCDTKAIEDNARAMCGTLIAECVVVGTG
RPSPVMFIEPGLEMNQDKLKKDIFRKIRLFHSRRYLHEQIVSPDMIVVVAKSTLPRTATKGNIRRQAVEEMFRLQ
IDDIFARVR*
Coding >AgabiH39|038030
ATGATAAAGACGCATCTTACCGTTCTTGAGGACGTCGCCTCAAAGTCAGCTCGTTCTGCCGCCTTCAGAATCCCC
GAGCTCGATACATCCAGCAATCGTGTCAAATCCTGGACGACAATCACATACGAAGAATTCTATCGTGATGTAGAG
ACGTTCGCAAAGTATTGGACACAGATCTTGGGGAGTAATAATATCCCGCAACGCTCAATTATTGGTGTTTGGCTA
AGCGGTTTTCTGTATACCGATGTTCTTCACATATACGGTCTTTCCCGAGCCGGCTACGTACCTCAGCTATTCAGC
ATACGCCTACCGAACCCCATCGTAATCTATGAACTCATGCGCAGAGCTGGCGCAAGCGCTCTCGTACACGACACC
TCCTTCTCAAGTATCCTAGGGGACAGTCCATACTTCACACATGCAGCAGAAGATGTTCGCCGTCTCGATCTCCAA
CACCTACGACTACGACCACTCCCCGATGTCACTTCTGAAGATTTGGCCTTCGTCTTCCACACCAGTGGATCAACG
TCAGGAAGCCCAAAGCTGGTGCGAGCAAACTATCGATGGCTATCATCTGCCTTGGAGAAATCGCATCATCTTTGC
TATCCATGTAGCCCGCAAAGGCAAGATGTGACAGTATTCATGGGTAGCATGTGTCATATTGCCCAGAACTTCATG
TTCCTTGGCACGCTCCAGCATGGCGCTTGCACTGTTCAGCCTACTGTCCTCAAATACTCGCCGGAGGAACTCAAG
GATATGGTTACCCGTTGCGGTTTGAATCGCCTCAACCAGTTCGCCAGCTTCCTCGGGAACCAACTTCGAGCATCA
CGTCAAGACTCGAGGCTATTATCCATGCTCATTTCTCTCGACGACGTGGTATATTCTGGACTCCCACTCCCGCGC
GAAGAAGAACAATATGCTTACAAGCACGGGATCAAGATCCGGAACCTGTTCGGTAGTACAGAAGTCGGCGCAATG
CTCCTATCAGGCGGCTGTGAACGCAATTTGTCCTTAGTGGCGCCTCTTCCTGGCACTTCATATCGATTCGTACCC
ACAGCTTCAAAATCCGAGCAAAACCAGTCGGCTCATCGCTCGAATGCCGAGCTCTTCGAGCTTGTTATCCTTTCT
GAATCCCCCGATTGTCCAGATGTATCTCTACGGCATGCAGATGGACATTTCCACACCGGAGATCTCTTCCAGGAA
GTCATGTCCGGCTTCTATCTATACCGCGGACGAGACGACGATTGGATAAAGTCGGAGAACAGCCTACGCTGCGAC
ACAAAGGCAATTGAAGATAACGCTAGAGCGATGTGCGGAACCCTTATTGCGGAGTGTGTGGTAGTCGGAACGGGT
CGTCCTTCACCCGTAATGTTTATAGAACCAGGCCTCGAGATGAACCAAGACAAGCTGAAAAAGGACATCTTCCGC
AAAATCCGCCTTTTCCATTCTCGACGCTATTTGCATGAACAGATCGTATCACCGGATATGATTGTTGTCGTAGCC
AAATCAACCCTGCCCCGAACAGCTACCAAGGGTAATATTCGTCGTCAAGCCGTAGAGGAGATGTTTAGATTACAG
ATTGACGATATTTTCGCTCGGGTGAGGTAA
Transcript >AgabiH39|038030
ATGATAAAGACGCATCTTACCGTTCTTGAGGACGTCGCCTCAAAGTCAGCTCGTTCTGCCGCCTTCAGAATCCCC
GAGCTCGATACATCCAGCAATCGTGTCAAATCCTGGACGACAATCACATACGAAGAATTCTATCGTGATGTAGAG
ACGTTCGCAAAGTATTGGACACAGATCTTGGGGAGTAATAATATCCCGCAACGCTCAATTATTGGTGTTTGGCTA
AGCGGTTTTCTGTATACCGATGTTCTTCACATATACGGTCTTTCCCGAGCCGGCTACGTACCTCAGCTATTCAGC
ATACGCCTACCGAACCCCATCGTAATCTATGAACTCATGCGCAGAGCTGGCGCAAGCGCTCTCGTACACGACACC
TCCTTCTCAAGTATCCTAGGGGACAGTCCATACTTCACACATGCAGCAGAAGATGTTCGCCGTCTCGATCTCCAA
CACCTACGACTACGACCACTCCCCGATGTCACTTCTGAAGATTTGGCCTTCGTCTTCCACACCAGTGGATCAACG
TCAGGAAGCCCAAAGCTGGTGCGAGCAAACTATCGATGGCTATCATCTGCCTTGGAGAAATCGCATCATCTTTGC
TATCCATGTAGCCCGCAAAGGCAAGATGTGACAGTATTCATGGGTAGCATGTGTCATATTGCCCAGAACTTCATG
TTCCTTGGCACGCTCCAGCATGGCGCTTGCACTGTTCAGCCTACTGTCCTCAAATACTCGCCGGAGGAACTCAAG
GATATGGTTACCCGTTGCGGTTTGAATCGCCTCAACCAGTTCGCCAGCTTCCTCGGGAACCAACTTCGAGCATCA
CGTCAAGACTCGAGGCTATTATCCATGCTCATTTCTCTCGACGACGTGGTATATTCTGGACTCCCACTCCCGCGC
GAAGAAGAACAATATGCTTACAAGCACGGGATCAAGATCCGGAACCTGTTCGGTAGTACAGAAGTCGGCGCAATG
CTCCTATCAGGCGGCTGTGAACGCAATTTGTCCTTAGTGGCGCCTCTTCCTGGCACTTCATATCGATTCGTACCC
ACAGCTTCAAAATCCGAGCAAAACCAGTCGGCTCATCGCTCGAATGCCGAGCTCTTCGAGCTTGTTATCCTTTCT
GAATCCCCCGATTGTCCAGATGTATCTCTACGGCATGCAGATGGACATTTCCACACCGGAGATCTCTTCCAGGAA
GTCATGTCCGGCTTCTATCTATACCGCGGACGAGACGACGATTGGATAAAGTCGGAGAACAGCCTACGCTGCGAC
ACAAAGGCAATTGAAGATAACGCTAGAGCGATGTGCGGAACCCTTATTGCGGAGTGTGTGGTAGTCGGAACGGGT
CGTCCTTCACCCGTAATGTTTATAGAACCAGGCCTCGAGATGAACCAAGACAAGCTGAAAAAGGACATCTTCCGC
AAAATCCGCCTTTTCCATTCTCGACGCTATTTGCATGAACAGATCGTATCACCGGATATGATTGTTGTCGTAGCC
AAATCAACCCTGCCCCGAACAGCTACCAAGGGTAATATTCGTCGTCAAGCCGTAGAGGAGATGTTTAGATTACAG
ATTGACGATATTTTCGCTCGGGTGAGGTAA
Gene >AgabiH39|038030
ATGATAAAGACGCATCTTACCGTTCTTGAGGACGTCGCCTCAAAGTCAGCTCGTTCTGCCGCCTTCAGAATCCCC
GAGCTCGATACATCCAGCAATCGTGTCAAATCCTGGACGACAATCACATACGAAGAATTCTATCGTGATGTAGAG
ACGTTCGCAAAGTATTGGACACAGATCTTGGGGAGTAATAATATCCCGCAACGCTCAATTATTGGTGTTTGGTAA
GTCCCACTAAATTACTCGTAGTCTCGCTTCGTCTAAACTCTGCTCCAGGCTAAGCGGTTTTCTGTATACCGATGT
TCTTCACATATACGGTCTTTCCCGAGCCGGCTACGTACCTCAGCTATTCAGCATACGCCTACCGAACCCCATCGT
AATCTATGAACTCATGCGCAGAGCTGGCGCAAGCGCTCTCGTACACGACACCTCCTTCTCAAGTATCCTAGGGGA
CAGTCCATACTTCACACATGCAGCAGAAGATGTTCGCCGTCTCGATCTCCAACACCTACGACTACGACCACTCCC
CGATGTCACTTCTGAAGATTTGGCCTTCGTCTTCCACACCAGTGGATCAACGTCAGGAAGCCCAAAGCTGGTGCG
AGCAAACTATCGATGGCTATCATCTGCCTTGGAGAAATCGCATCATCTTTGCTATCCATGTAGCCCGCAAAGGCA
AGATGTGACAGTATTCATGTGCGTCTCTCAACCATTCATTCTACATTTGACCTAATTGAATTTTCTATACAGGGG
TAGCATGTGTCATATTGCCCAGAACTTCAGTAAGTACATGTTCTAGAGCCTTTAGTTAGAACCAGTTCCTAACGT
TTGTGAACAGTGTTCCTTGGCACGCTCCAGCATGGCGCTTGCACTGTTCAGCCTACTGTCCTCAAATACTCGCCG
GAGGAACTCAAGGATATGGTTACCCGTTGCGGTTTGAATCGCCTCAACCAGTTCGCCAGCTTCCTCGGGAACCAA
CTTCGAGCATCACGTCAAGACTCGAGGCTATTATCCATGCTCATTTCTCTCGACGACGTGGTATATTCTGGACTC
CCACTCCCGCGCGAAGAAGAACAATATGCTTACAAGCACGGGATCAAGATCCGGGTACGTTTATATTCAACCTTT
CAAACATGATTTACGGACTGGAACTAAATAATGTGCTTCGTCCTCTAGAACCTGTTCGGTAGTACAGAAGTCGGC
GCAATGCTCCTATCAGGCGGCTGTGAACGCAATTTGTCCTTAGTGGCGCCTCTTCCTGGCACTTCATATCGATTC
GTACCCACAGCTTCAAAATCCGAGCAAAACCAGTCGGCTCATCGCTCGAATGCCGAGCTCTTCGAGCTTGTTATC
CTTTCTGAATCCCCCGATTGTCCAGATGTATCTCTACGGCATGCAGATGGACATTTCCACACCGGAGATCTCTTC
CAGGAAGTCATGTCCGGCTTCTATCTATACCGCGGACGAGACGACGATTGGATAAAGTCGGAGAACAGCCTACGC
TGCGACACAAAGGCAATTGAAGATAACGCTAGAGCGATGTGCGGAACCCTTATTGCGGAGTGTGTGGTAGTCGGA
ACGGGTCGTCCTTCACCCGTAATGTTTATAGAACCAGGCCTCGAGATGAACCAAGACAAGCTGAAAAAGGACATC
TTCCGCAAAATCCGCCTTTTCCATTCTCGACGCTATTTGCATGAACAGATCGTATCACCGGATATGATTGTTGTC
GTAGCCAAATCAACCCTGCCCCGAACAGCTACCAAGGGTAATATTCGTCGTCAAGCCGTAGAGGAGATGTTTAGA
TTACAGATTGACGATATTTTCGCTCGGGTGAGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail