Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|033590
Gene name
Locationscaffold_13:11755..12187
Strand+
Gene length (bp)432
Transcript length (bp)432
Coding sequence length (bp)432
Protein length (aa) 144

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup12233
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|033590 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|033590

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|033590
MRPKMSLLLALSSLDYSPAFLAEVHSDYLDKGLSGHFLRLDKLGLLDRRFIVSKKRTKQLIDLTAMWRRTVLERR
DHQATEVPAPTLSRGTAAPSTQTELRTSIVAKVAAAPQPVRRRPPVRTGPLDAWLIHRDAPPGEDNDV*
Coding >AgabiH39|033590
ATGCGCCCGAAGATGTCTCTACTCCTGGCGTTGAGTAGTCTGGATTATTCCCCGGCCTTTTTGGCTGAGGTACAT
TCGGATTATCTTGACAAAGGGTTGTCAGGGCATTTTCTGCGGCTCGACAAACTCGGCCTTCTAGATCGCCGCTTT
ATTGTGTCTAAAAAACGCACGAAGCAATTGATCGACCTTACCGCCATGTGGCGTCGGACCGTTCTGGAGCGCCGT
GATCACCAAGCAACAGAAGTGCCTGCTCCGACACTTAGTCGTGGTACGGCGGCGCCTTCAACGCAGACGGAGCTT
CGTACTTCGATTGTCGCGAAGGTTGCTGCTGCGCCGCAACCAGTTAGGAGACGGCCGCCTGTACGTACAGGTCCG
CTTGACGCGTGGTTAATTCATCGGGATGCGCCTCCGGGTGAGGACAACGACGTTTGA
Transcript >AgabiH39|033590
ATGCGCCCGAAGATGTCTCTACTCCTGGCGTTGAGTAGTCTGGATTATTCCCCGGCCTTTTTGGCTGAGGTACAT
TCGGATTATCTTGACAAAGGGTTGTCAGGGCATTTTCTGCGGCTCGACAAACTCGGCCTTCTAGATCGCCGCTTT
ATTGTGTCTAAAAAACGCACGAAGCAATTGATCGACCTTACCGCCATGTGGCGTCGGACCGTTCTGGAGCGCCGT
GATCACCAAGCAACAGAAGTGCCTGCTCCGACACTTAGTCGTGGTACGGCGGCGCCTTCAACGCAGACGGAGCTT
CGTACTTCGATTGTCGCGAAGGTTGCTGCTGCGCCGCAACCAGTTAGGAGACGGCCGCCTGTACGTACAGGTCCG
CTTGACGCGTGGTTAATTCATCGGGATGCGCCTCCGGGTGAGGACAACGACGTTTGA
Gene >AgabiH39|033590
ATGCGCCCGAAGATGTCTCTACTCCTGGCGTTGAGTAGTCTGGATTATTCCCCGGCCTTTTTGGCTGAGGTACAT
TCGGATTATCTTGACAAAGGGTTGTCAGGGCATTTTCTGCGGCTCGACAAACTCGGCCTTCTAGATCGCCGCTTT
ATTGTGTCTAAAAAACGCACGAAGCAATTGATCGACCTTACCGCCATGTGGCGTCGGACCGTTCTGGAGCGCCGT
GATCACCAAGCAACAGAAGTGCCTGCTCCGACACTTAGTCGTGGTACGGCGGCGCCTTCAACGCAGACGGAGCTT
CGTACTTCGATTGTCGCGAAGGTTGCTGCTGCGCCGCAACCAGTTAGGAGACGGCCGCCTGTACGTACAGGTCCG
CTTGACGCGTGGTTAATTCATCGGGATGCGCCTCCGGGTGAGGACAACGACGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail