Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|031990
Gene name
Locationscaffold_12b:962754..965386
Strand-
Gene length (bp)2632
Transcript length (bp)2307
Coding sequence length (bp)2307
Protein length (aa) 769

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07250 Glyoxal_oxid_N Glyoxal oxidase N-terminus 3.1E-17 225 326
PF09118 GO-like_E_set Galactose oxidase-like, Early set domain 5.3E-19 506 613

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 95 632 2.0E-29

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 35 0.970935

Transmembrane Domains

Domain # Start End Length
1 664 686 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA5_1 1.7E-219 34 634

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1124
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|031980
Agaricus bisporus var bisporus H39 AgabiH39|031990 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|031980
Agaricus bisporus var bisporus H97 AgabiH97|031990
Rhodonia placenta FPRL280 RhoplFPRL280|258_1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|031990
MLGDVSLAPTANMLRHPLLSLYYLWLASAVTHVAAQKAGSFADGGNTQVSAMMMFVGNEEKVYMLDKAENNPAQI
KGHPAWGSVWDLNTHNVELMDVRTNVFCSSGMHLPNGSFIAMGGNGAVGPGGNIGSQLNPQNGAADWDSVYQDFD
GGKAIRLLNPCDSAKNFNEPECQWFDDPTVLSMHQRRWYSAAEALEDGSVVIIGGFANGGYINRNYPNVDPEFEG
GAAVCTYEYFPPRNENPKTFDFLIKTSGLNAYPHSYLLPSGKLFVQANVSSVIWDHNANVETPLPDMPHGVVRVY
PASGATAMLPLTPDNDYNPTILFCGGSDMPEYAYGNYSFPFIDTFYYPASKDCQRITPEPKDGSAPAYEQDDDML
ESRTMGQFIVLPDLKLLVVNGGLNGTAGYSQATGETTSYSLMPYGESLAAGPVGTPAIYDPKAPKGQRWSDAGLA
TSDIARLYHSSAMLLPDASILIAGSNPNVDVNTSTIYPTTYQAEIFYPPYFSAGTRPQPSGMPKQLTYGGNPFDI
TIPPTSYSGSSNDAAASAMVTLIRGGFTTHAMNMGQRGMQLRNSFTVKQDGTIILHVAQPPPNPYIYQPGPAFLY
TLINGIPSNGSYVILGNGQIGQQPTAEDSTLPDSVRADGAKGAGSPNSNVNDGSDTSGSHKGAIIGGVVAAIVGI
AVVGLVLGVFFIRRKKSAPNASNGYNMGGPSSMAAAASSEQLMVASGPGSNGAGFRGSDSSAFLPFKESSTFRDS
EDMHQNQMGPPAMHNPYR*
Coding >AgabiH39|031990
ATGTTAGGCGATGTCTCGCTGGCTCCGACGGCGAACATGCTTCGCCATCCACTCCTTTCGTTATATTACCTTTGG
CTCGCGTCGGCCGTAACACATGTCGCCGCACAGAAGGCGGGTTCGTTTGCCGATGGTGGCAACACACAAGTTAGT
GCAATGATGATGTTCGTTGGGAATGAGGAAAAAGTGTATATGTTAGACAAAGCAGAAAACAACCCTGCTCAAATC
AAAGGACATCCTGCATGGGGATCCGTTTGGGACTTGAACACGCACAATGTTGAACTAATGGACGTTAGGACGAAC
GTGTTCTGTTCGTCTGGTATGCATCTACCAAACGGGTCCTTCATCGCAATGGGTGGCAATGGCGCTGTTGGTCCT
GGTGGTAATATTGGTTCGCAACTCAATCCACAAAATGGAGCAGCAGATTGGGACTCCGTGTACCAGGATTTCGAT
GGTGGAAAAGCCATTCGTCTGCTAAATCCATGTGACTCGGCGAAAAACTTTAATGAACCAGAATGCCAATGGTTT
GACGACCCGACGGTTCTTTCAATGCATCAGAGGCGGTGGTATTCAGCTGCAGAAGCCTTGGAAGATGGAAGTGTC
GTGATCATCGGTGGATTCGCCAATGGAGGCTATATAAATCGCAATTATCCAAATGTCGATCCCGAGTTTGAAGGT
GGAGCTGCTGTTTGTACATATGAATATTTTCCTCCCAGAAACGAAAACCCGAAGACATTTGACTTCCTCATCAAG
ACCTCAGGATTGAACGCTTACCCGCACTCTTACCTTTTGCCTTCGGGTAAATTGTTCGTTCAAGCAAATGTGTCA
TCAGTGATCTGGGATCACAACGCCAACGTTGAGACCCCGCTTCCTGATATGCCCCATGGAGTTGTCCGTGTCTAC
CCTGCTTCGGGTGCTACCGCCATGCTTCCTCTGACTCCCGACAATGACTATAATCCGACGATCCTCTTTTGTGGT
GGCAGCGACATGCCTGAATATGCGTACGGCAATTACTCTTTCCCCTTCATCGACACTTTCTATTACCCGGCCTCA
AAGGATTGTCAACGCATTACTCCCGAACCTAAGGATGGGTCTGCCCCTGCTTATGAACAGGATGACGATATGTTG
GAAAGCCGGACGATGGGCCAATTCATTGTACTTCCAGATCTGAAGCTTCTTGTAGTCAATGGGGGTCTTAATGGC
ACAGCGGGGTATTCTCAAGCAACCGGTGAAACTACCTCATACAGCCTCATGCCTTACGGCGAGTCTCTTGCAGCT
GGACCTGTTGGTACGCCCGCGATCTACGACCCCAAAGCTCCCAAAGGTCAAAGATGGTCTGATGCGGGGTTGGCT
ACGTCGGACATCGCTCGTCTCTACCACTCCTCTGCCATGCTTCTTCCTGATGCGTCAATCCTCATTGCTGGTTCT
AACCCCAATGTCGACGTCAATACTTCGACGATCTATCCGACGACTTACCAGGCTGAGATATTCTATCCGCCATAT
TTTTCTGCCGGGACACGGCCTCAACCCAGTGGCATGCCAAAGCAACTCACTTATGGTGGCAATCCCTTTGATATT
ACCATCCCCCCTACCTCGTATTCTGGTTCGAGTAACGATGCAGCTGCGAGTGCAATGGTCACTTTGATTCGTGGT
GGATTCACGACACATGCTATGAACATGGGACAGCGTGGAATGCAGCTCAGGAATTCCTTCACAGTCAAGCAAGAT
GGTACCATTATCCTGCACGTTGCGCAACCACCACCTAATCCTTACATTTATCAACCTGGCCCTGCTTTTCTCTAT
ACTCTCATCAATGGCATTCCATCAAATGGTTCATACGTGATCCTTGGCAACGGACAAATTGGCCAGCAGCCGACT
GCAGAGGACAGTACGCTTCCCGACAGCGTTCGCGCTGATGGTGCCAAGGGGGCGGGATCCCCGAACTCAAATGTC
AATGATGGTAGTGATACTTCAGGTTCTCACAAGGGAGCGATCATTGGAGGAGTAGTGGCTGCTATCGTGGGTATT
GCCGTAGTTGGACTGGTCCTCGGAGTATTCTTTATTCGTCGAAAGAAGTCTGCACCAAACGCCAGTAATGGGTAT
AATATGGGTGGACCATCAAGCATGGCTGCGGCAGCATCGAGCGAACAACTCATGGTAGCGTCTGGACCTGGAAGT
AACGGCGCGGGATTTAGAGGCTCCGACTCGAGTGCTTTCTTGCCGTTCAAAGAATCGTCGACATTTAGAGATTCG
GAGGATATGCATCAAAACCAGATGGGCCCGCCGGCCATGCATAATCCATATCGGTGA
Transcript >AgabiH39|031990
ATGTTAGGCGATGTCTCGCTGGCTCCGACGGCGAACATGCTTCGCCATCCACTCCTTTCGTTATATTACCTTTGG
CTCGCGTCGGCCGTAACACATGTCGCCGCACAGAAGGCGGGTTCGTTTGCCGATGGTGGCAACACACAAGTTAGT
GCAATGATGATGTTCGTTGGGAATGAGGAAAAAGTGTATATGTTAGACAAAGCAGAAAACAACCCTGCTCAAATC
AAAGGACATCCTGCATGGGGATCCGTTTGGGACTTGAACACGCACAATGTTGAACTAATGGACGTTAGGACGAAC
GTGTTCTGTTCGTCTGGTATGCATCTACCAAACGGGTCCTTCATCGCAATGGGTGGCAATGGCGCTGTTGGTCCT
GGTGGTAATATTGGTTCGCAACTCAATCCACAAAATGGAGCAGCAGATTGGGACTCCGTGTACCAGGATTTCGAT
GGTGGAAAAGCCATTCGTCTGCTAAATCCATGTGACTCGGCGAAAAACTTTAATGAACCAGAATGCCAATGGTTT
GACGACCCGACGGTTCTTTCAATGCATCAGAGGCGGTGGTATTCAGCTGCAGAAGCCTTGGAAGATGGAAGTGTC
GTGATCATCGGTGGATTCGCCAATGGAGGCTATATAAATCGCAATTATCCAAATGTCGATCCCGAGTTTGAAGGT
GGAGCTGCTGTTTGTACATATGAATATTTTCCTCCCAGAAACGAAAACCCGAAGACATTTGACTTCCTCATCAAG
ACCTCAGGATTGAACGCTTACCCGCACTCTTACCTTTTGCCTTCGGGTAAATTGTTCGTTCAAGCAAATGTGTCA
TCAGTGATCTGGGATCACAACGCCAACGTTGAGACCCCGCTTCCTGATATGCCCCATGGAGTTGTCCGTGTCTAC
CCTGCTTCGGGTGCTACCGCCATGCTTCCTCTGACTCCCGACAATGACTATAATCCGACGATCCTCTTTTGTGGT
GGCAGCGACATGCCTGAATATGCGTACGGCAATTACTCTTTCCCCTTCATCGACACTTTCTATTACCCGGCCTCA
AAGGATTGTCAACGCATTACTCCCGAACCTAAGGATGGGTCTGCCCCTGCTTATGAACAGGATGACGATATGTTG
GAAAGCCGGACGATGGGCCAATTCATTGTACTTCCAGATCTGAAGCTTCTTGTAGTCAATGGGGGTCTTAATGGC
ACAGCGGGGTATTCTCAAGCAACCGGTGAAACTACCTCATACAGCCTCATGCCTTACGGCGAGTCTCTTGCAGCT
GGACCTGTTGGTACGCCCGCGATCTACGACCCCAAAGCTCCCAAAGGTCAAAGATGGTCTGATGCGGGGTTGGCT
ACGTCGGACATCGCTCGTCTCTACCACTCCTCTGCCATGCTTCTTCCTGATGCGTCAATCCTCATTGCTGGTTCT
AACCCCAATGTCGACGTCAATACTTCGACGATCTATCCGACGACTTACCAGGCTGAGATATTCTATCCGCCATAT
TTTTCTGCCGGGACACGGCCTCAACCCAGTGGCATGCCAAAGCAACTCACTTATGGTGGCAATCCCTTTGATATT
ACCATCCCCCCTACCTCGTATTCTGGTTCGAGTAACGATGCAGCTGCGAGTGCAATGGTCACTTTGATTCGTGGT
GGATTCACGACACATGCTATGAACATGGGACAGCGTGGAATGCAGCTCAGGAATTCCTTCACAGTCAAGCAAGAT
GGTACCATTATCCTGCACGTTGCGCAACCACCACCTAATCCTTACATTTATCAACCTGGCCCTGCTTTTCTCTAT
ACTCTCATCAATGGCATTCCATCAAATGGTTCATACGTGATCCTTGGCAACGGACAAATTGGCCAGCAGCCGACT
GCAGAGGACAGTACGCTTCCCGACAGCGTTCGCGCTGATGGTGCCAAGGGGGCGGGATCCCCGAACTCAAATGTC
AATGATGGTAGTGATACTTCAGGTTCTCACAAGGGAGCGATCATTGGAGGAGTAGTGGCTGCTATCGTGGGTATT
GCCGTAGTTGGACTGGTCCTCGGAGTATTCTTTATTCGTCGAAAGAAGTCTGCACCAAACGCCAGTAATGGGTAT
AATATGGGTGGACCATCAAGCATGGCTGCGGCAGCATCGAGCGAACAACTCATGGTAGCGTCTGGACCTGGAAGT
AACGGCGCGGGATTTAGAGGCTCCGACTCGAGTGCTTTCTTGCCGTTCAAAGAATCGTCGACATTTAGAGATTCG
GAGGATATGCATCAAAACCAGATGGGCCCGCCGGCCATGCATAATCCATATCGGTGA
Gene >AgabiH39|031990
ATGTTAGGCGAGTGCTAGGCTGAGCTGGGCTTGGATCCGGAGGGCCTTCAAAGTTTCAGGGTCGTTGGTGGCAGG
GGGCCTCTGCTGAATTTTAATAAGTGTCGTGTGTCCTTGTTGCCACCTCTCTCTTGTCTTCCCCCCTCACGTTCT
GTTTTTTAGTCGCTGGCTCCGACGGCGAACATGCTTCGCCATCCACTCCTTTCGTTATATTACCTTTGGCTCGCG
TCGGCCGTAACACATGTCGCCGCACAGAAGGCGGGTTCGTTTGCCGATGGTGGCAACACACAAGTTAGTGCAATG
ATGGTACGCTGCTTATTCTCCTTGGATTTCGCGACAATCCCTGATGCTCGTCTTTAGATGTTCGTTGGGAATGAG
GAAAAAGTGTATATGTTAGACAAAGCAGAAAACAACCCTGCTCAAATCAAAGGACATCCTGCATGGGGATCCGTT
TGGTAGGTGGACCAGTTGGAGACCCTCGCCGATTGCTTCGCGACGCTAATATGCTTCTTCATCAGGGACTTGAAC
ACGCACAATGTTGAACTAATGGACGTTAGGACGAACGTGTTCTGTTCGTCTGGTATGCATCTACCAAACGGGTCC
TTCATCGCAATGGGTGGCAATGGCGCTGTTGGTCCTGGTGGTAATATTGGTTCGCAACTCAATCCACAAAATGGA
GCAGCAGATTGGGACTCCGTGTACCAGGATTTCGATGGTGGAAAAGCCATTCGTCTGCTAAATCCATGTGACTCG
GCGAAAAACTTTAATGAACCAGAATGCCAATGGTTTGACGACCCGACGGTTCTTTCAATGCATCAGAGGCGGTGG
TATTCAGCTGCAGAAGCCTTGGAAGATGGAAGTGTCGTGATCATCGGTGGATTCGCCAATGGAGGCTATATAAAT
CGCAATTATCCAAATGTCGATCCCGAGTTTGAAGGTGGAGCTGCTGTTTGTACATATGAATATTTTCCTCCCAGA
AACGAAAACCCGAAGACATTTGACTTCCTCATCAAGACCTCAGGATTGAACGCTTACCCGCACTCTTACCTTTTG
CCTTCGGGTAAATTGTTCGTTCAAGCAAATGTGTCATCAGGTGTGTTCTATATAGGATTTTAAATCTTGGAAATT
TTGATTGATACATGCGCCTTGTTACATAGTGATCTGGGATCACAACGCCAACGTTGAGACCCCGCTTCCTGATAT
GCCCCATGGAGTTGTCCGTGTCTACCCTGCTTCGGGTGCTACCGCCATGCTTCCTCTGACTCCCGACAATGACTA
TAATCCGACGATCCTCTTTTGTGGTGGCAGCGACATGCCTGAATATGCGTACGGCAATTACTCTTTCCCCTTCAT
CGACACTTTCTATTACCCGGCCTCAAAGGATTGTCAACGCATTACTCCCGAACCTAAGGATGGGTCTGCCCCTGC
TTATGAACAGGATGACGATATGTTGGAAAGCCGGACGATGGGCCAATTCATTGTACTTCCAGATCTGAAGCTTCT
TGTAGTCAATGGGGGTCTTAATGGCACAGCGGGGTATTCTCAAGCAACCGGTGAAACTACCTCATACAGCCTCAT
GCCTTACGGCGAGTCTCTTGCAGCTGGACCTGTTGGTACGCCCGCGATCTACGACCCCAAAGCTCCCAAAGGTCA
AAGATGGTCTGATGCGGGGTTGGCTACGTCGGACATCGCTCGTCTCTACCACTCCTCTGCCATGCTTCTTCCTGA
TGCGTCAATCCTCATTGCTGGTTCTAACCCCAATGTCGACGTCAATACTTCGACGATCTATCCGACGACTTACCA
GGCTGAGATATTCTATCCGCCATATTTTTCTGCCGGGACACGGCCTCAACCCAGTGGCATGCCAAAGCAACTCAC
TTATGGTGGCAATCCCTTTGATATTACCATCCCCCCTACCTCGTATTCTGGTTCGAGTAACGATGCAGCTGCGAG
TGCAATGGTCACTTTGATTCGTGGTGGATTCACGACACATGCTATGAACATGGGACAGCGTGGAATGCAGCTCAG
GAATTCCTTCACAGTCAAGCAAGATGGTACCATTATCCTGCACGTTGCGCAACCACCACCTAATCCTTACATTTA
TCAACCTGGCCCTGCTTTTCTCTATACTCTCATCAATGGCATTCCATCAAATGGTTCATACGTGATCCTTGGCAA
CGGACAAATTGGCCAGCAGCCGACTGCAGAGGACAGTACGCTTCCCGACAGCGTTCGCGCTGATGGTGCCAAGGG
GGCGGGATCCCCGAACTCAAATGTCAATGATGGTAGTGATACTTCAGGTTCTCACAAGGGAGCGATCATTGGAGG
AGTAGTGGCTGCTATCGTGGGTATTGCCGTAGTTGGACTGGTCCTCGGAGTATTCTTTATTCGTCGAAAGAAGTC
TGCACCAAACGCCAGTAATGGGTATAATATGGGTGGACCATCAAGCATGGCTGCGGCAGCATCGAGCGAACAACT
CATGGTAGCGTCTGGACCTGGAAGTAACGGCGCGGGATTTAGAGGCTCCGACTCGAGTGCTTTCTTGCCGTTCAA
AGAATCGTCGACATTTAGAGATTCGGAGGATATGCATCAAAACCAGATGGGCCCGCCGGCCATGCATAATCCATA
TCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail