Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|029810
Gene name
Locationscaffold_12b:324008..327431
Strand-
Gene length (bp)3423
Transcript length (bp)3231
Coding sequence length (bp)3231
Protein length (aa) 1077

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18044 zf-CCCH_4 CCCH-type zinc finger 1.3E-07 13 32
PF18044 zf-CCCH_4 CCCH-type zinc finger 5.9E-08 79 100
PF01485 IBR IBR domain, a half RING-finger domain 3.8E-09 778 838
PF01485 IBR IBR domain, a half RING-finger domain 8.5E-07 862 895
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 9.4E-04 14 32
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.9E-01 80 99
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 1.4E-04 13 32
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.1E-04 709 742

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 660 914 7.0E-42
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 660 914 2.0E-39
sp|P36113|HEL1_YEAST E3 ubiquitin-protein ligase HEL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEL1 PE=1 SV=1 709 899 2.0E-18
sp|Q7Z419|R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens GN=RNF144B PE=1 SV=1 724 909 1.0E-17
sp|Q9P3U4|HEL1_SCHPO E3 ubiquitin-protein ligase dbl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbl4 PE=3 SV=1 706 896 4.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 660 914 7.0E-42
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 660 914 2.0E-39
sp|P36113|HEL1_YEAST E3 ubiquitin-protein ligase HEL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEL1 PE=1 SV=1 709 899 2.0E-18
sp|Q7Z419|R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens GN=RNF144B PE=1 SV=1 724 909 1.0E-17
sp|Q9P3U4|HEL1_SCHPO E3 ubiquitin-protein ligase dbl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbl4 PE=3 SV=1 706 896 4.0E-17
sp|Q8BKD6|R144B_MOUSE E3 ubiquitin-protein ligase RNF144B OS=Mus musculus GN=Rnf144b PE=2 SV=2 724 909 4.0E-17
sp|Q54CX4|Y5521_DICDI Uncharacterized protein DDB_G0292642 OS=Dictyostelium discoideum GN=DDB_G0292642 PE=3 SV=2 709 932 5.0E-17
sp|A4IIY1|R144A_XENTR Probable E3 ubiquitin-protein ligase RNF144A OS=Xenopus tropicalis GN=rnf144a PE=2 SV=1 724 909 5.0E-17
sp|A5PK27|R144B_BOVIN E3 ubiquitin-protein ligase RNF144B OS=Bos taurus GN=RNF144B PE=2 SV=1 724 908 1.0E-16
sp|Q6DH94|R1442_DANRE Probable E3 ubiquitin-protein ligase RNF144A-B OS=Danio rerio GN=rnf144ab PE=2 SV=1 724 909 2.0E-16
sp|Q925F3|R144A_MOUSE E3 ubiquitin-protein ligase RNF144A OS=Mus musculus GN=Rnf144a PE=1 SV=1 724 909 1.0E-15
sp|Q4KLT0|RN217_XENLA Probable E3 ubiquitin-protein ligase RNF217 OS=Xenopus laevis GN=rnf217 PE=2 SV=1 709 905 2.0E-15
sp|Q8L829|ARI5_ARATH Probable E3 ubiquitin-protein ligase ARI5 OS=Arabidopsis thaliana GN=ARI5 PE=2 SV=1 706 898 3.0E-15
sp|O76924|ARI2_DROME Protein ariadne-2 OS=Drosophila melanogaster GN=ari-2 PE=2 SV=1 694 896 1.0E-14
sp|Q9SKC3|ARI9_ARATH Probable E3 ubiquitin-protein ligase ARI9 OS=Arabidopsis thaliana GN=ARI9 PE=2 SV=1 709 898 1.0E-14
sp|P50876|R144A_HUMAN E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens GN=RNF144A PE=1 SV=2 724 909 2.0E-14
sp|Q5RFV4|R1441_DANRE Probable E3 ubiquitin-protein ligase RNF144A-A OS=Danio rerio GN=rnf144aa PE=3 SV=1 724 909 2.0E-14
sp|Q949V6|ARI1_ARATH Probable E3 ubiquitin-protein ligase ARI1 OS=Arabidopsis thaliana GN=ARI1 PE=2 SV=1 690 928 2.0E-14
sp|Q84RR0|ARI7_ARATH Probable E3 ubiquitin-protein ligase ARI7 OS=Arabidopsis thaliana GN=ARI7 PE=2 SV=1 706 898 3.0E-14
sp|Q8W468|ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8 OS=Arabidopsis thaliana GN=ARI8 PE=2 SV=1 661 898 6.0E-14
sp|Q9LVW9|ARI4_ARATH Putative E3 ubiquitin-protein ligase ARI4 OS=Arabidopsis thaliana GN=ARI4 PE=5 SV=2 709 907 2.0E-13
sp|Q9Y4X5|ARI1_HUMAN E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens GN=ARIH1 PE=1 SV=2 693 896 7.0E-13
sp|B1H1E4|ARI1_XENTR E3 ubiquitin-protein ligase arih1 OS=Xenopus tropicalis GN=arih1 PE=2 SV=1 693 896 7.0E-13
sp|Q6ZMZ0|RN19B_HUMAN E3 ubiquitin-protein ligase RNF19B OS=Homo sapiens GN=RNF19B PE=1 SV=2 691 895 7.0E-13
sp|Q9Z1K5|ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus GN=Arih1 PE=1 SV=3 693 896 7.0E-13
sp|A2VEA3|ARI1_BOVIN E3 ubiquitin-protein ligase ARIH1 OS=Bos taurus GN=ARIH1 PE=2 SV=1 693 896 7.0E-13
sp|Q9SKC4|ARI10_ARATH Probable E3 ubiquitin-protein ligase ARI10 OS=Arabidopsis thaliana GN=ARI10 PE=2 SV=1 709 894 8.0E-13
sp|Q9LVX0|ARI3_ARATH Probable E3 ubiquitin-protein ligase ARI3 OS=Arabidopsis thaliana GN=ARI3 PE=2 SV=1 702 904 1.0E-12
sp|Q6NW85|ARI1L_DANRE E3 ubiquitin-protein ligase arih1l OS=Danio rerio GN=arih1l PE=2 SV=1 699 896 1.0E-12
sp|Q9Z1K6|ARI2_MOUSE E3 ubiquitin-protein ligase ARIH2 OS=Mus musculus GN=Arih2 PE=1 SV=1 687 896 1.0E-12
sp|Q22431|ARI2_CAEEL Probable protein ariadne-2 OS=Caenorhabditis elegans GN=T12E12.1 PE=3 SV=2 698 900 2.0E-12
sp|Q6PFJ9|ARI1_DANRE E3 ubiquitin-protein ligase arih1 OS=Danio rerio GN=arih1 PE=2 SV=1 699 896 2.0E-12
sp|O95376|ARI2_HUMAN E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens GN=ARIH2 PE=1 SV=1 687 896 2.0E-12
sp|Q32NS4|ARI1_XENLA E3 ubiquitin-protein ligase arih1 OS=Xenopus laevis GN=arih1 PE=2 SV=1 693 896 2.0E-12
sp|Q84RR2|ARI2_ARATH Probable E3 ubiquitin-protein ligase ARI2 OS=Arabidopsis thaliana GN=ARI2 PE=2 SV=1 722 928 4.0E-12
sp|Q9SKC2|ARI11_ARATH Probable E3 ubiquitin-protein ligase ARI11 OS=Arabidopsis thaliana GN=ARI11 PE=2 SV=1 709 895 5.0E-12
sp|A2A7Q9|RN19B_MOUSE E3 ubiquitin-protein ligase RNF19B OS=Mus musculus GN=Rnf19b PE=1 SV=2 709 895 8.0E-12
sp|Q9NWF9|RN216_HUMAN E3 ubiquitin-protein ligase RNF216 OS=Homo sapiens GN=RNF216 PE=1 SV=3 709 894 1.0E-11
sp|P0C8K8|ARI6_ARATH Putative E3 ubiquitin-protein ligase ARI6 OS=Arabidopsis thaliana GN=ARI6 PE=5 SV=1 706 898 1.0E-11
sp|Q6T486|RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum GN=rbrA PE=3 SV=1 709 896 3.0E-11
sp|P58283|RN216_MOUSE E3 ubiquitin-protein ligase RNF216 OS=Mus musculus GN=Rnf216 PE=1 SV=3 709 894 3.0E-11
sp|Q9US46|ITT1_SCHPO E3 ubiquitin-protein ligase itt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itt1 PE=3 SV=1 709 909 3.0E-11
sp|Q9P2G1|AKIB1_HUMAN Ankyrin repeat and IBR domain-containing protein 1 OS=Homo sapiens GN=ANKIB1 PE=1 SV=3 705 895 1.0E-10
sp|Q9NV58|RN19A_HUMAN E3 ubiquitin-protein ligase RNF19A OS=Homo sapiens GN=RNF19A PE=1 SV=3 693 895 3.0E-10
sp|Q2VJ60|RN19A_PIG E3 ubiquitin-protein ligase RNF19A OS=Sus scrofa GN=RNF19A PE=2 SV=1 693 895 3.0E-10
sp|D3YYI7|RN217_MOUSE Probable E3 ubiquitin-protein ligase RNF217 OS=Mus musculus GN=Rnf217 PE=3 SV=2 815 905 3.0E-10
sp|Q8TC41|RN217_HUMAN Probable E3 ubiquitin-protein ligase RNF217 OS=Homo sapiens GN=RNF217 PE=2 SV=4 815 905 5.0E-10
sp|P50636|RN19A_MOUSE E3 ubiquitin-protein ligase RNF19A OS=Mus musculus GN=Rnf19a PE=1 SV=2 693 895 5.0E-10
sp|Q1L8G6|AKIB1_DANRE Ankyrin repeat and IBR domain-containing protein 1 OS=Danio rerio GN=ankib1 PE=3 SV=1 709 895 2.0E-09
sp|Q9BYM8|HOIL1_HUMAN RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Homo sapiens GN=RBCK1 PE=1 SV=2 709 893 2.0E-09
sp|Q9UBS8|RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens GN=RNF14 PE=1 SV=1 720 909 4.0E-09
sp|Q6ZPS6|AKIB1_MOUSE Ankyrin repeat and IBR domain-containing protein 1 OS=Mus musculus GN=Ankib1 PE=1 SV=2 705 895 6.0E-09
sp|Q8IWT3|CUL9_HUMAN Cullin-9 OS=Homo sapiens GN=CUL9 PE=1 SV=2 709 895 8.0E-09
sp|Q1L8L6|RN19B_DANRE E3 ubiquitin-protein ligase RNF19B OS=Danio rerio GN=rnf19b PE=3 SV=2 709 895 3.0E-08
sp|Q08B84|RN19B_XENLA E3 ubiquitin-protein ligase RNF19B OS=Xenopus laevis GN=rnf19b PE=2 SV=2 709 986 3.0E-08
sp|E6ZIJ1|HOIL1_DICLA RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Dicentrarchus labrax GN=rbck1 PE=3 SV=1 709 896 4.0E-08
sp|Q9JI90|RNF14_MOUSE E3 ubiquitin-protein ligase RNF14 OS=Mus musculus GN=Rnf14 PE=1 SV=2 720 938 5.0E-08
sp|Q94981|ARI1_DROME Protein ariadne-1 OS=Drosophila melanogaster GN=ari-1 PE=1 SV=2 709 898 2.0E-07
sp|Q04638|ITT1_YEAST Translation termination inhibitor protein ITT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITT1 PE=1 SV=1 860 913 1.0E-06
sp|Q5UQ35|YR811_MIMIV Putative ariadne-like RING finger protein R811 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R811 PE=3 SV=1 862 913 8.0E-06
sp|Q80TT8|CUL9_MOUSE Cullin-9 OS=Mus musculus GN=Cul9 PE=1 SV=2 780 895 8.0E-06
sp|Q9WUB0|HOIL1_MOUSE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Mus musculus GN=Rbck1 PE=1 SV=2 709 893 9.0E-06
sp|A9JTG5|HOIL1_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio GN=rbck1 PE=2 SV=1 724 896 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup716
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|029810 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|516000
Agaricus bisporus var bisporus H97 AgabiH97|029790
Agaricus bisporus var bisporus H97 AgabiH97|029800
Agaricus bisporus var bisporus H97 AgabiH97|029810

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|029810
MVQGTLEKSPQQVCRFYIRGRCTFGNNCKFSHTTPSGDRLANDTSRAEDKSSNTPNSTSSHRVTGSNESKVKPLA
KVNKPCRLWQGGSCKWGDKCRFRHDAEAGSPTVTQSVDATPIPNRVGVTPSVDTSETKVRPAATTQMEERRQPVN
KKGFKSNDQAAAVRRERQKQLDQEREARKEAKEKQRIEQRRKQEEDWAKEATFTIQRVVLNSFVRFEAGLTIQHV
ICGFEASQILIKNLPLNAQRSEIIALFTQQGVDPNDLVILKMETVDGHSQATVLGRATDVGVIAVGLDGIEFRDE
NLEFVVCERTSDGRTMGSSNRDFHLLTISYPKPSLTMVVRYPDIGTFEAGENKRKLDGKILNGQRIRAEVTADGF
NGFNEDYLPSYAIELSRIPADTTVAEVQTLTNTRNVQLRHNPFSYKSDEVFNAIESHLRSLPGSTLQRLTPDNSS
RPNFVSVKAFFNTWESAKSARDSLSGKFLRLGFPSLRVFLSDPYRFVLTLDENQYNSQKAQWSELCEGKRKEVTI
QTRTVDRGRRRSVIITLFGRDKKMVGALKVRIEGMAAGQRLDASYWHPVFKDYKYLEFFDDLYHSTGAYFRSDWK
HNRLTASGSIDAVEAAKARIKDEIDRIAAEQWTIPLQRRALGFFIREGLAKMKGLLGEENVTLDVNSAKIVLHGA
DLEEARHHLRQLMDTFMNRNASSSSNTASDENPCPVCYDNVSEPFEIGCQHIYCSSCLRHYILSTFDNHSFPLKC
MGNDATCNQPLSLPLIQRFLPHQRFETLMEAAFRSYIDKNPETFKYCNTPDCSQVYRATTSPQVLQCPSCFAEVC
TACHNEGHTGLTCAERLAQKDVGEQERLLRRWAAGSGAKRCPSCQAWVEKTEGCNHMSCNCGAHFCWICLGVFAS
DRIYGHMNEVHGGISTDPEAAARRPERNNVPDIVDVVGGPAAAAEQMAAFRRIEAERANRGQPPANGIVAERPAR
PFVNRVPAGVGWGAGQEARRDQPLQAEAERRRREIRNIMEREEARRTAERRREEDRQLALRAQYIRTQRETQQAG
REEVRRREAEARRRETQENKGWCTIM*
Coding >AgabiH39|029810
ATGGTTCAAGGAACATTGGAGAAGTCGCCACAACAAGTCTGCAGATTTTATATAAGAGGAAGATGTACCTTCGGG
AACAATTGCAAGTTTTCTCATACTACGCCGTCAGGCGACAGGCTCGCGAATGATACTAGCCGGGCGGAAGATAAG
AGTTCAAATACGCCGAACTCGACGTCCTCTCATAGAGTGACGGGGTCGAATGAGTCAAAAGTGAAACCACTTGCT
AAAGTTAATAAGCCATGTAGGCTGTGGCAAGGAGGTAGCTGTAAATGGGGAGATAAGTGTCGATTTCGACATGAT
GCTGAGGCTGGGTCGCCTACTGTTACTCAAAGTGTTGATGCTACACCGATTCCTAACCGTGTAGGTGTTACGCCC
TCTGTGGATACTAGTGAGACGAAGGTCCGTCCTGCGGCGACGACCCAAATGGAAGAGAGGCGACAACCTGTGAAC
AAGAAAGGGTTCAAATCCAACGACCAAGCAGCGGCAGTCCGCCGGGAAAGGCAAAAACAATTAGACCAAGAAAGG
GAGGCACGAAAAGAAGCGAAAGAAAAGCAAAGAATTGAACAACGTCGTAAGCAAGAGGAAGATTGGGCTAAGGAG
GCGACCTTCACGATCCAAAGAGTCGTTCTCAACTCGTTTGTTCGATTTGAAGCTGGACTAACCATCCAACACGTT
ATATGCGGTTTCGAAGCATCTCAAATCCTTATCAAGAACCTTCCTTTGAATGCACAGAGATCCGAGATCATTGCG
CTCTTCACTCAACAGGGTGTCGATCCTAATGATCTTGTCATACTCAAAATGGAAACTGTGGATGGGCATTCGCAG
GCTACTGTACTGGGAAGAGCGACAGATGTGGGGGTTATTGCTGTGGGTTTGGATGGGATAGAGTTTCGGGATGAG
AATCTCGAATTTGTGGTTTGCGAGAGGACTTCGGATGGTCGTACCATGGGTTCTTCGAATCGAGACTTTCATCTT
CTCACCATATCTTATCCCAAACCATCCCTCACTATGGTCGTCAGGTATCCCGACATCGGAACATTCGAGGCAGGA
GAAAATAAGAGGAAACTGGACGGAAAAATTCTTAATGGACAGAGGATTCGCGCAGAAGTTACCGCTGATGGTTTT
AATGGTTTTAATGAAGACTACTTACCTTCTTATGCTATCGAGCTTTCCAGAATACCCGCAGACACCACCGTAGCC
GAGGTCCAAACCCTTACCAACACCCGAAATGTCCAACTTCGTCATAATCCCTTCTCATACAAGTCTGATGAAGTG
TTCAATGCAATAGAATCTCATCTCCGCAGTCTACCTGGATCGACTTTACAAAGGCTCACCCCTGATAACTCTTCC
CGTCCCAATTTCGTTTCCGTCAAAGCCTTTTTTAACACTTGGGAAAGTGCCAAATCTGCTCGGGATAGCCTTTCC
GGAAAATTTTTGAGGCTTGGATTTCCTTCCCTTCGTGTCTTTCTATCCGACCCCTATCGATTCGTACTCACTCTG
GACGAGAACCAATATAATTCTCAAAAGGCTCAATGGTCTGAATTATGTGAGGGAAAGAGAAAGGAGGTGACCATC
CAGACAAGGACCGTTGATCGAGGTAGAAGAAGGAGCGTCATTATCACTTTGTTCGGGCGCGATAAAAAGATGGTA
GGTGCCTTGAAGGTACGCATCGAGGGTATGGCTGCTGGCCAGAGGCTCGATGCGTCCTATTGGCACCCCGTCTTC
AAGGATTACAAATACCTCGAATTCTTCGACGACCTCTACCATAGCACTGGTGCCTACTTTCGTAGCGATTGGAAA
CACAATCGCCTGACAGCGTCGGGTTCTATCGACGCGGTTGAAGCTGCCAAGGCACGTATAAAGGACGAAATTGAC
CGTATCGCGGCAGAACAATGGACTATACCGCTTCAACGTCGTGCTTTGGGATTCTTCATCCGCGAGGGTCTGGCG
AAGATGAAAGGACTGCTTGGAGAGGAGAACGTCACTCTGGACGTAAACTCTGCGAAAATTGTGCTCCATGGTGCT
GACCTCGAAGAGGCCAGACACCACCTCAGGCAACTCATGGACACTTTCATGAATCGGAATGCGTCGTCATCATCC
AATACAGCTTCGGATGAAAATCCATGCCCAGTTTGTTACGATAACGTCTCAGAACCATTCGAGATTGGGTGTCAA
CATATCTATTGCTCGTCTTGTCTTCGTCATTATATTCTTTCTACCTTCGATAACCATAGTTTCCCGTTGAAATGC
ATGGGAAACGATGCGACCTGCAATCAACCTCTTTCGCTTCCTCTCATCCAGAGATTCTTGCCTCACCAGCGGTTT
GAGACGTTAATGGAAGCTGCCTTCCGCTCATATATTGACAAGAATCCCGAGACGTTCAAATACTGTAACACGCCG
GATTGCTCTCAGGTATATCGCGCTACCACTTCCCCTCAAGTACTACAGTGCCCGTCATGCTTCGCCGAAGTGTGT
ACGGCATGTCATAACGAGGGCCACACTGGATTGACTTGTGCGGAAAGGCTTGCGCAGAAGGATGTAGGAGAACAA
GAACGACTGCTAAGGCGATGGGCAGCCGGAAGTGGTGCCAAGCGATGTCCGTCTTGTCAAGCATGGGTCGAGAAA
ACCGAAGGGTGCAATCATATGAGTTGTAATTGTGGCGCACACTTTTGTTGGATCTGTCTAGGGGTTTTCGCTTCG
GATCGCATCTACGGTCATATGAACGAAGTGCATGGTGGAATTTCTACTGACCCGGAAGCTGCCGCAAGACGTCCT
GAGCGTAACAATGTACCAGATATTGTAGATGTTGTTGGTGGACCGGCGGCGGCGGCCGAACAAATGGCAGCGTTC
CGTCGCATTGAAGCAGAACGTGCCAACCGAGGCCAACCACCGGCCAATGGGATTGTTGCTGAGCGTCCAGCTAGA
CCCTTTGTAAACCGTGTGCCTGCAGGTGTAGGATGGGGTGCGGGACAGGAGGCACGAAGGGATCAGCCACTGCAG
GCCGAAGCCGAACGAAGAAGACGCGAGATACGAAACATTATGGAAAGAGAAGAAGCTAGGAGGACAGCGGAACGA
AGACGCGAGGAGGACAGGCAATTGGCATTGAGGGCGCAGTATATACGGACACAACGTGAGACCCAACAGGCAGGA
AGAGAAGAAGTTAGGAGAAGAGAAGCGGAAGCCCGGCGACGGGAGACACAAGAGAACAAGGGATGGTGTACGATT
ATGTAG
Transcript >AgabiH39|029810
ATGGTTCAAGGAACATTGGAGAAGTCGCCACAACAAGTCTGCAGATTTTATATAAGAGGAAGATGTACCTTCGGG
AACAATTGCAAGTTTTCTCATACTACGCCGTCAGGCGACAGGCTCGCGAATGATACTAGCCGGGCGGAAGATAAG
AGTTCAAATACGCCGAACTCGACGTCCTCTCATAGAGTGACGGGGTCGAATGAGTCAAAAGTGAAACCACTTGCT
AAAGTTAATAAGCCATGTAGGCTGTGGCAAGGAGGTAGCTGTAAATGGGGAGATAAGTGTCGATTTCGACATGAT
GCTGAGGCTGGGTCGCCTACTGTTACTCAAAGTGTTGATGCTACACCGATTCCTAACCGTGTAGGTGTTACGCCC
TCTGTGGATACTAGTGAGACGAAGGTCCGTCCTGCGGCGACGACCCAAATGGAAGAGAGGCGACAACCTGTGAAC
AAGAAAGGGTTCAAATCCAACGACCAAGCAGCGGCAGTCCGCCGGGAAAGGCAAAAACAATTAGACCAAGAAAGG
GAGGCACGAAAAGAAGCGAAAGAAAAGCAAAGAATTGAACAACGTCGTAAGCAAGAGGAAGATTGGGCTAAGGAG
GCGACCTTCACGATCCAAAGAGTCGTTCTCAACTCGTTTGTTCGATTTGAAGCTGGACTAACCATCCAACACGTT
ATATGCGGTTTCGAAGCATCTCAAATCCTTATCAAGAACCTTCCTTTGAATGCACAGAGATCCGAGATCATTGCG
CTCTTCACTCAACAGGGTGTCGATCCTAATGATCTTGTCATACTCAAAATGGAAACTGTGGATGGGCATTCGCAG
GCTACTGTACTGGGAAGAGCGACAGATGTGGGGGTTATTGCTGTGGGTTTGGATGGGATAGAGTTTCGGGATGAG
AATCTCGAATTTGTGGTTTGCGAGAGGACTTCGGATGGTCGTACCATGGGTTCTTCGAATCGAGACTTTCATCTT
CTCACCATATCTTATCCCAAACCATCCCTCACTATGGTCGTCAGGTATCCCGACATCGGAACATTCGAGGCAGGA
GAAAATAAGAGGAAACTGGACGGAAAAATTCTTAATGGACAGAGGATTCGCGCAGAAGTTACCGCTGATGGTTTT
AATGGTTTTAATGAAGACTACTTACCTTCTTATGCTATCGAGCTTTCCAGAATACCCGCAGACACCACCGTAGCC
GAGGTCCAAACCCTTACCAACACCCGAAATGTCCAACTTCGTCATAATCCCTTCTCATACAAGTCTGATGAAGTG
TTCAATGCAATAGAATCTCATCTCCGCAGTCTACCTGGATCGACTTTACAAAGGCTCACCCCTGATAACTCTTCC
CGTCCCAATTTCGTTTCCGTCAAAGCCTTTTTTAACACTTGGGAAAGTGCCAAATCTGCTCGGGATAGCCTTTCC
GGAAAATTTTTGAGGCTTGGATTTCCTTCCCTTCGTGTCTTTCTATCCGACCCCTATCGATTCGTACTCACTCTG
GACGAGAACCAATATAATTCTCAAAAGGCTCAATGGTCTGAATTATGTGAGGGAAAGAGAAAGGAGGTGACCATC
CAGACAAGGACCGTTGATCGAGGTAGAAGAAGGAGCGTCATTATCACTTTGTTCGGGCGCGATAAAAAGATGGTA
GGTGCCTTGAAGGTACGCATCGAGGGTATGGCTGCTGGCCAGAGGCTCGATGCGTCCTATTGGCACCCCGTCTTC
AAGGATTACAAATACCTCGAATTCTTCGACGACCTCTACCATAGCACTGGTGCCTACTTTCGTAGCGATTGGAAA
CACAATCGCCTGACAGCGTCGGGTTCTATCGACGCGGTTGAAGCTGCCAAGGCACGTATAAAGGACGAAATTGAC
CGTATCGCGGCAGAACAATGGACTATACCGCTTCAACGTCGTGCTTTGGGATTCTTCATCCGCGAGGGTCTGGCG
AAGATGAAAGGACTGCTTGGAGAGGAGAACGTCACTCTGGACGTAAACTCTGCGAAAATTGTGCTCCATGGTGCT
GACCTCGAAGAGGCCAGACACCACCTCAGGCAACTCATGGACACTTTCATGAATCGGAATGCGTCGTCATCATCC
AATACAGCTTCGGATGAAAATCCATGCCCAGTTTGTTACGATAACGTCTCAGAACCATTCGAGATTGGGTGTCAA
CATATCTATTGCTCGTCTTGTCTTCGTCATTATATTCTTTCTACCTTCGATAACCATAGTTTCCCGTTGAAATGC
ATGGGAAACGATGCGACCTGCAATCAACCTCTTTCGCTTCCTCTCATCCAGAGATTCTTGCCTCACCAGCGGTTT
GAGACGTTAATGGAAGCTGCCTTCCGCTCATATATTGACAAGAATCCCGAGACGTTCAAATACTGTAACACGCCG
GATTGCTCTCAGGTATATCGCGCTACCACTTCCCCTCAAGTACTACAGTGCCCGTCATGCTTCGCCGAAGTGTGT
ACGGCATGTCATAACGAGGGCCACACTGGATTGACTTGTGCGGAAAGGCTTGCGCAGAAGGATGTAGGAGAACAA
GAACGACTGCTAAGGCGATGGGCAGCCGGAAGTGGTGCCAAGCGATGTCCGTCTTGTCAAGCATGGGTCGAGAAA
ACCGAAGGGTGCAATCATATGAGTTGTAATTGTGGCGCACACTTTTGTTGGATCTGTCTAGGGGTTTTCGCTTCG
GATCGCATCTACGGTCATATGAACGAAGTGCATGGTGGAATTTCTACTGACCCGGAAGCTGCCGCAAGACGTCCT
GAGCGTAACAATGTACCAGATATTGTAGATGTTGTTGGTGGACCGGCGGCGGCGGCCGAACAAATGGCAGCGTTC
CGTCGCATTGAAGCAGAACGTGCCAACCGAGGCCAACCACCGGCCAATGGGATTGTTGCTGAGCGTCCAGCTAGA
CCCTTTGTAAACCGTGTGCCTGCAGGTGTAGGATGGGGTGCGGGACAGGAGGCACGAAGGGATCAGCCACTGCAG
GCCGAAGCCGAACGAAGAAGACGCGAGATACGAAACATTATGGAAAGAGAAGAAGCTAGGAGGACAGCGGAACGA
AGACGCGAGGAGGACAGGCAATTGGCATTGAGGGCGCAGTATATACGGACACAACGTGAGACCCAACAGGCAGGA
AGAGAAGAAGTTAGGAGAAGAGAAGCGGAAGCCCGGCGACGGGAGACACAAGAGAACAAGGGATGGTGTACGATT
ATGTAG
Gene >AgabiH39|029810
ATGGTTCAAGGAACATTGGAGAAGTCGCCACAACAAGTCTGCAGATTTTATATAAGAGGAAGATGTACCTTCGGG
AACAATTGCAAGTTTTCTCATACTGTTTGTTTATTCGTCTTGAACCCTTTCCTGTTGCTCTGCTGATCGTACTTA
CTAGACGCCGTCAGGCGACAGGCTCGCGAATGATACTAGCCGGGCGGAAGATAAGAGTTCAAATACGCCGTATGT
CTTTGATTACTTGTATCTGCGAAAACCCCTGGTGATCAATTGATTTCTCATGTGTTGTTTTTAGGAACTCGACGT
CCTCTCATAGAGTGACGGGGTCGAATGAGTCAAAAGTGAAACCACTTGCTAAAGTTAATAAGCCATGTAGGCTGT
GGCAAGGAGGTAGCTGTAAATGGGGAGATAAGTGTCGATTTCGACATGATGCTGAGGTATGGGGTTTGTGATGAC
TCGCTATGAGCGCTTGACTGATAATCTTGGTTGATTTTATTTGTATAGGCTGGGTCGCCTACTGTTACTCAAAGT
GTTGATGCTACACCGATTCCTAACCGTGTAGGTGTTACGCCCTCTGTGGATACTAGTGAGACGAAGGTCCGTCCT
GCGGCGACGACCCAAATGGAAGAGAGGCGACAACCTGTGAACAAGAAAGGGTTCAAATCCAACGACCAAGCAGCG
GCAGTCCGCCGGGAAAGGCAAAAACAATTAGACCAAGAAAGGGAGGCACGAAAAGAAGCGAAAGAAAAGCAAAGA
ATTGAACAACGTCGTAAGCAAGAGGAAGATTGGGCTAAGGAGGCGACCTTCACGATCCAAAGAGTCGTTCTCAAC
TCGTTTGTTCGATTTGAAGCTGGACTAACCATCCAACACGTTATATGCGGTTTCGAAGCATCTCAAATCCTTATC
AAGAACCTTCCTTTGAATGCACAGAGATCCGAGATCATTGCGCTCTTCACTCAACAGGGTGTCGATCCTAATGAT
CTTGTCATACTCAAAATGGAAACTGTGGATGGGCATTCGCAGGCTACTGTACTGGGAAGAGCGACAGATGTGGGG
GTTATTGCTGTGGGTTTGGATGGGATAGAGTTTCGGGATGAGAATCTCGAATTTGTGGTTTGCGAGAGGACTTCG
GATGGTCGTACCATGGGTTCTTCGAATCGAGACTTTCATCTTCTCACCATATCTTATCCCAAACCATCCCTCACT
ATGGTCGTCAGGTATCCCGACATCGGAACATTCGAGGCAGGAGAAAATAAGAGGAAACTGGACGGAAAAATTCTT
AATGGACAGAGGATTCGCGCAGAAGTTACCGCTGATGGTTTTAATGGTTTTAATGAAGACTACTTACCTTCTTAT
GCTATCGAGCTTTCCAGAATACCCGCAGACACCACCGTAGCCGAGGTCCAAACCCTTACCAACACCCGAAATGTC
CAACTTCGTCATAATCCCTTCTCATACAAGTCTGATGAAGTGTTCAATGCAATAGAATCTCATCTCCGCAGTCTA
CCTGGATCGACTTTACAAAGGCTCACCCCTGATAACTCTTCCCGTCCCAATTTCGTTTCCGTCAAAGCCTTTTTT
AACACTTGGGAAAGTGCCAAATCTGCTCGGGATAGCCTTTCCGGAAAATTTTTGAGGCTTGGATTTCCTTCCCTT
CGTGTCTTTCTATCCGACCCCTATCGATTCGTACTCACTCTGGACGAGAACCAATATAATTCTCAAAAGGCTCAA
TGGTCTGAATTATGTGAGGGAAAGAGAAAGGAGGTGACCATCCAGACAAGGACCGTTGATCGAGGTAGAAGAAGG
AGCGTCATTATCACTTTGTTCGGGCGCGATAAAAAGATGGTAGGTGCCTTGAAGGTACGCATCGAGGGTATGGCT
GCTGGCCAGAGGCTCGATGCGTCCTATTGGCACCCCGTCTTCAAGGATTACAAATACCTCGAATTCTTCGACGAC
CTCTACCATAGCACTGGTGCCTACTTTCGTAGCGATTGGAAACACAATCGCCTGACAGCGTCGGGTTCTATCGAC
GCGGTTGAAGCTGCCAAGGCACGTATAAAGGACGAAATTGACCGTATCGCGGCAGAACAATGGACTATACCGCTT
CAACGTCGTGCTTTGGGATTCTTCATCCGCGAGGGTCTGGCGAAGATGAAAGGACTGCTTGGAGAGGAGAACGTC
ACTCTGGACGTAAACTCTGCGAAAATTGTGCTCCATGGTGCTGACCTCGAAGAGGCCAGACACCACCTCAGGCAA
CTCATGGACACTTTCATGAATCGGAATGCGTCGTCATCATCCAATACAGCTTCGGATGAAAATCCATGCCCAGTT
TGTTACGATAACGTCTCAGAACCATTCGAGATTGGGTGTCAACATATCTATTGCTCGTCTTGTCTTCGTCATTAT
ATTCTTTCTACCTTCGATAACCATAGTTTCCCGTTGAAATGCATGGGAAACGATGCGACCTGCAATCAACCTCTT
TCGCTTCCTCTCATCCAGAGATTCTTGCCTCACCAGCGGTTTGAGACGTTAATGGAAGCTGCCTTCCGCTCATAT
ATTGACAAGAATCCCGAGACGTTCAAATACTGTAACACGCCGGATTGCTCTCAGGTATATCGCGCTACCACTTCC
CCTCAAGTACTACAGTGCCCGTCATGCTTCGCCGAAGTGTGTACGGCATGTCATAACGAGGGCCACACTGGATTG
ACTTGTGCGGAAAGGCTTGCGCAGAAGGATGTAGGAGAACAAGAACGACTGCTAAGGCGATGGGCAGCCGGAAGT
GGTGCCAAGCGATGTCCGTCTTGTCAAGCATGGGTCGAGAAAACCGAAGGGTGCAATCATATGAGTTGTAATTGT
GGCGCACACTTTTGTTGGATCTGTCTAGGGGTTTTCGCTTCGGATCGCATCTACGGTCATATGAACGAAGTGCAT
GGTGGAATTTCTACTGACCCGGAAGCTGCCGCAAGACGTCCTGAGCGTAACAATGTACCAGATATTGTAGATGTT
GTTGGTGGACCGGCGGCGGCGGCCGAACAAATGGCAGCGTTCCGTCGCATTGAAGCAGAACGTGCCAACCGAGGC
CAACCACCGGCCAATGGGATTGTTGCTGAGCGTCCAGCTAGACCCTTTGTAAACCGTGTGCCTGCAGGTGTAGGA
TGGGGTGCGGGACAGGAGGCACGAAGGGATCAGCCACTGCAGGCCGAAGCCGAACGAAGAAGACGCGAGATACGA
AACATTATGGAAAGAGAAGAAGCTAGGAGGACAGCGGAACGAAGACGCGAGGAGGACAGGCAATTGGCATTGAGG
GCGCAGTATATACGGACACAACGTGAGACCCAACAGGCAGGAAGAGAAGAAGTTAGGAGAAGAGAAGCGGAAGCC
CGGCGACGGGAGACACAAGAGAACAAGGGATGGTGTACGATTATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail