Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|028790
Gene name
Locationscaffold_12b:67684..68479
Strand+
Gene length (bp)795
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 28 0.99967

Transmembrane Domains

Domain # Start End Length
1 9 31 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup7246
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|028790 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|028790
Rhodonia placenta FPRL280 RhoplFPRL280|81_15

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|028790
MAYYHLNKNYLSGVILLVILCHLSGALAALYPTQPVAKTVFATGSSALVTWKDDTHVPHVYDLGDLVIKLYTAQA
VYVATLALGVNPNSFGTQVTFPADLRNDTLYFLTFRGPGLQRDIYTANFAIVSDPTLVKASSTTLSAVPPVQSLL
ADGSMNSTAANMNLTSPGQQMFTSTTMLPVSTVAADQYGSPYRNNGAVHSRASQLEQAKFRLLFVVWPIMFGLSM
AF*
Coding >AgabiH39|028790
ATGGCTTACTACCACCTAAACAAAAACTATCTTTCGGGCGTTATCCTTCTGGTGATTCTATGCCATCTCTCTGGG
GCTCTTGCGGCGCTCTACCCAACACAGCCTGTGGCAAAAACGGTCTTTGCTACTGGAAGCTCTGCTCTTGTGACT
TGGAAGGACGATACTCATGTTCCCCATGTATATGATCTAGGCGATCTGGTGATCAAGTTGTATACAGCTCAAGCT
GTATACGTAGCGACCTTGGCTCTGGGCGTAAATCCGAACTCGTTTGGAACTCAGGTGACGTTTCCGGCCGATTTA
CGGAACGATACTCTCTATTTCCTTACATTCCGCGGTCCTGGACTTCAACGTGACATATATACGGCCAACTTCGCT
ATAGTTTCAGATCCCACCTTGGTTAAAGCGTCTTCAACAACGCTAAGCGCAGTTCCCCCGGTCCAATCCTTACTC
GCTGATGGCTCGATGAATTCTACAGCGGCGAATATGAATTTAACATCACCAGGACAACAAATGTTTACGAGCACT
ACCATGCTACCGGTGTCGACTGTCGCCGCTGATCAATACGGATCACCTTATAGAAACAATGGTGCAGTACACAGC
CGGGCTAGTCAACTGGAGCAGGCGAAATTCAGACTTTTGTTCGTTGTCTGGCCGATCATGTTTGGATTGTCGATG
GCATTTTAA
Transcript >AgabiH39|028790
ATGGCTTACTACCACCTAAACAAAAACTATCTTTCGGGCGTTATCCTTCTGGTGATTCTATGCCATCTCTCTGGG
GCTCTTGCGGCGCTCTACCCAACACAGCCTGTGGCAAAAACGGTCTTTGCTACTGGAAGCTCTGCTCTTGTGACT
TGGAAGGACGATACTCATGTTCCCCATGTATATGATCTAGGCGATCTGGTGATCAAGTTGTATACAGCTCAAGCT
GTATACGTAGCGACCTTGGCTCTGGGCGTAAATCCGAACTCGTTTGGAACTCAGGTGACGTTTCCGGCCGATTTA
CGGAACGATACTCTCTATTTCCTTACATTCCGCGGTCCTGGACTTCAACGTGACATATATACGGCCAACTTCGCT
ATAGTTTCAGATCCCACCTTGGTTAAAGCGTCTTCAACAACGCTAAGCGCAGTTCCCCCGGTCCAATCCTTACTC
GCTGATGGCTCGATGAATTCTACAGCGGCGAATATGAATTTAACATCACCAGGACAACAAATGTTTACGAGCACT
ACCATGCTACCGGTGTCGACTGTCGCCGCTGATCAATACGGATCACCTTATAGAAACAATGGTGCAGTACACAGC
CGGGCTAGTCAACTGGAGCAGGCGAAATTCAGACTTTTGTTCGTTGTCTGGCCGATCATGTTTGGATTGTCGATG
GCATTTTAA
Gene >AgabiH39|028790
ATGGCTTACTACCACCTAAACAAAAACTATCTTTCGGGCGTTATCCTTCTGGTGATTCTATGCCATCTCTCTGGG
GCTCTTGCGGCGCTCTACCCAACACAGCCTGTGGCAAAAACGGTCTTTGCTACTGGAAGCTCTGCTCTTGTGACT
TGGAAGGACGATACTCATGTTCCCCATGTATATGATCTAGGCGATCTGGTGATCAAGTTGTATACAGCTCAAGCT
GTAAGTCCTCCAGGAGCGTGCAGAGTCCGAAGTCTGACTGACTATGTGACTATATGCGCAGGTATACGTAGCGAC
CTTGGCTCTGGGCGTAAATCCGAACTCGTTTGGAACTCAGGTGACGTTTCCGGCCGATTTACGGAACGATACTCT
CTAGTAAGCTATCTCGCTTGGGACGCCGTGCGCCAATCTGAGAATTTGTCGAGTTTCCTTACATTCCGCGGTCCT
GGACTTCAACGTGACATATATACGGCCAACTTCGCTATAGTTTCAGATCCCACCTTGGTTAAAGCGTCTTCAACA
ACGCTAAGCGCAGTTCCCCCGGTCCAATCCTTACTCGCTGATGGCTCGATGAATTCTACAGCGGCGAATATGAAT
TTAACATCACCAGGACAACAAATGTTTACGAGCACTACCATGCTACCGGTGTCGACTGTCGCCGCTGATCAATAC
GGATCACCTTATAGAAACAATGGTGCAGTACACAGCCGGGCTAGTCAACTGGAGCAGGCGAAATTCAGACTTTTG
TTCGTTGTCTGGCCGATCATGTTTGGATTGTCGATGGCATTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail